KEGG   Buchnera aphidicola APS (Acyrthosiphon pisum): BU279Help
Entry
BU279             CDS       T00036                                 

Gene name
trpC
Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase (EC:4.1.1.48 5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
buc  Buchnera aphidicola APS (Acyrthosiphon pisum)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:buc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BU279 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BU279 (trpC)
Enzymes [BR:buc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BU279 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     BU279 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(303964..305325)
Genome map
AA seq 453 aa AA seqDB search
MQDTTLKKIIQDKSEWIRLRKEKQPLIDFKDKINKKTRDFYHSLKEKKPCFILEYKKKSP
SLGIIRNNFNLIEISNVYKKYASSVSVLTDEKYFHGNLNFINIVRECVSQPVLCKDFFID
PYQVYLSRYYNADAILLMLSVLNDIQYKELSIIAKKLNMGILTEVNNIEELKRALKLNAN
IIGINNRNLHDLSIDLNRTRTLSSLIKKDTIIISESGIKKYREIKELSKFVNGFLIGSHL
MSQTNLETAVRSIIFGDNKVCGLTRSIDIEVSEKYGAIYGGLIFVKNSPRYITKKTAKNI
SINRKLKLIGIFQNENINIIVDIAEELSLYGVQLHGQENKQYIDKLRNILPKKINIWKAF
SIQSELPDRNWDNVNMYIFDSDSGGSNTSFNWSILNHHILDNVILAGGINLKNCITASKL
KCSGLDLNSGVEISPGIKDYKKIKSIFQKLRYG
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacacaacacttaaaaaaattatacaagataaaagtgaatggattagattaaga
aaagaaaaacagcctttaattgattttaaagataaaataaataaaaaaacacgggatttt
taccattctttaaaagaaaaaaaaccatgttttatattagaatataaaaagaaatctcct
tctttaggtattattagaaacaattttaatttaattgaaatttctaatgtttacaaaaaa
tatgcatcttctgtttcagtcctgacagatgaaaaatattttcatggaaatttaaatttt
ataaatatagtaagagaatgtgtttctcaacctgttttatgcaaagatttttttattgat
ccatatcaagtatatttatctagatattataatgcagatgctattttattaatgttatct
gttttaaatgatatacagtataaagaactatctataattgcaaaaaaattaaatatgggc
atactaactgaagtaaataatatagaggaattaaaacgtgctctaaaattaaatgctaat
attataggtattaacaatcgcaatttgcatgatttatcaattgatttaaatcgtacacgt
actttatcttctttaattaaaaaagatactataataataagcgaatcaggtataaaaaaa
tatagagaaataaaagaacttagtaaatttgtcaatggttttttaattggttctcatttg
atgtctcaaactaatttagagacagccgttcgttctataatttttggtgataataaagtc
tgcggattaactcgtagtatagatatagaagtttctgaaaaatacggagcaatttacggc
ggacttatttttgtaaaaaattctcctcgttatattactaaaaaaactgcaaaaaatatt
tctataaatagaaaattaaaattgatcggaatttttcaaaatgaaaatatcaatattatc
gtagatattgctgaagaactatcactttatggtgtacaactgcatggacaagaaaataaa
caatatattgataaattaaggaatatactacctaaaaaaatcaatatttggaaagctttt
tctattcaatcagaattgccagatcgcaattgggacaatgtaaatatgtatatatttgac
tctgattctggaggaagtaatacatcttttaattggtctattttaaaccatcatatttta
gataatgttattttagctggaggaattaatttaaagaattgtattacagcttctaaacta
aaatgctcaggattagatttaaattccggcgtagaaatatctcctggtattaaagactac
aagaaaataaaatcaatttttcaaaaattaagatatggttaa

DBGET integrated database retrieval system