KEGG   Buchnera aphidicola APS (Acyrthosiphon pisum): BU303Help
Entry
BU303             CDS       T00036                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
buc  Buchnera aphidicola APS (Acyrthosiphon pisum)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:buc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BU303 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BU303 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BU303 (sucB)
Enzymes [BR:buc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BU303 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
335888..337150
Genome map
AA seq 420 aa AA seqDB search
MKKINILVPDLPESISDATVVKWHKKIGDTVHCDDNIVDIETDKVMLEVSSPCDGILQSI
LEKEGKVVISQQTLGEINKSTVVDNHLSNNHIIEKEDNLLKKEEKYITTEEKKEIEYLLK
DNHKHLTPSMRRSVKIHNINNGFLNQVIETSKKTNFENIIKEEKKESNQILFNHNIFNAN
ENNKNNNNKVTNRVKMTRLRQRIAERLLDSKNNTAMLTTFHEVNMKPIILLRKKYGEDFE
KKHNVRIGFMSFFVKAVIQALKNFPEINAYIDQTDIVFYKNFDISIAISTPRGLITPVIR
NADTMTMAEIEKKIKDFSIKGLQNKINIKELMGGNFTITNGGVFGSLMSTPIINPPQTAI
LGMHVIQERPVVVNGQIKILPMMYLALSYDHRLIDGKESVGFLINIKNILEDFNRIAIDV
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataaatattcttgttccagatttaccagaatctattagtgatgcaacagtt
gtaaaatggcacaaaaaaataggagatacagttcactgtgatgataatatagttgatatt
gaaacagataaagtcatgttagaagtatcttctccatgtgatggaatattacaatcaatt
ttagaaaaagaagggaaagtagttatatctcaacaaacacttggtgaaataaacaaatct
actgtggttgataaccatctttccaataatcatattattgaaaaagaagataatttatta
aaaaaagaagaaaaatatataactacggaagaaaaaaaagaaatagaatatttattaaaa
gataatcacaaacatctgactccatctatgagacgatcagtcaaaatacataatattaat
aatggttttttaaatcaagtgatcgaaacaagtaaaaaaactaattttgaaaatattata
aaagaagaaaaaaaagaatcgaatcaaattttattcaatcataatatatttaatgcgaat
gaaaataataaaaataataataataaggttacgaatcgagtaaaaatgactcgattacga
caaagaattgcagaacgattactagatagcaaaaataatacagctatgctaactactttt
catgaagtaaatatgaaaccaatcatacttttacgtaaaaagtatggtgaagattttgaa
aaaaaacataatgttagaattggatttatgtctttttttgtaaaagcagtcattcaagca
ttaaaaaattttccagaaattaatgcttacatagatcaaacagatatagttttttataaa
aatttcgacatcagtattgctatttcgacgccaagagggttgattactccggtaataaga
aatgctgatacaatgacaatggcagaaattgaaaaaaaaataaaggatttttctataaaa
ggattgcaaaataaaatcaatataaaagaattaatgggtggcaatttcaccattactaat
ggtggtgtttttggttccttaatgtcgactcctattattaaccctcctcaaacagccata
ttaggtatgcatgtaattcaagaacgtccagtagttgtaaatggacaaattaaaattctt
ccaatgatgtatttagcattatcttatgatcatcgtttaatagatggaaaagaatctgtc
ggttttttaatcaatataaaaaatatattagaagattttaatcgtattgcaattgatgtg
tag

DBGET integrated database retrieval system