KEGG   Buchnera aphidicola APS (Acyrthosiphon pisum): BU304Help
Entry
BU304             CDS       T00036                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
buc  Buchnera aphidicola APS (Acyrthosiphon pisum)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:buc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BU304 (gpmA)
   01230 Biosynthesis of amino acids
    BU304 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BU304 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BU304 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BU304 (gpmA)
Enzymes [BR:buc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BU304 (gpmA)
Exosome [BR:buc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BU304 (gpmA)
  Exosomal proteins of melanoma cells
   BU304 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
337248..337943
Genome map
AA seq 231 aa AA seqDB search
MKINQVVLIRHGQSEWNTLNKFTGWHDAELDKKGKDEAKFAAILLKKEKFFFDCAHTSLL
KRAIHTLQYILDELNQTWLSVKKSWRLNERHYGALEGLNKDEVIEKYGQKQVLLWRRSFD
ISPPQINIKDKRFPGNDPRYSHLNIHDIPLGESLEKTAKRVIPYWNKIVYPELKNNKKIL
IVAHGNSLRALIQHLYKIDNKAILDLNIPTAQPIILDFDNEKNPIKWHYLT
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaatcaagtagttttaattagacatggtcaaagcgaatggaatacattaaat
aaatttactggttggcatgatgctgaattagataaaaaaggaaaagatgaagctaaattt
gctgctatcttattaaaaaaagaaaaatttttttttgattgcgcacatacatcattatta
aaaagagcaattcatactttgcaatatattttagatgaattaaaccaaacctggttgtca
gttaaaaaatcctggcgtttaaacgaacgacattatggtgcattagaagggttaaataaa
gatgaagttattgagaaatatggacaaaaacaagttcttctatggagaagaagttttgat
attagtccacctcagattaatataaaagataaacgctttccaggaaacgatccacgctac
tctcatttaaatattcatgacatccctctaggagagagcttagaaaaaactgcaaaacga
gttattccttattggaacaaaattgtttatccagaattaaaaaataataaaaaaatactt
attgtagcgcatggaaattctttacgtgccttgatacaacacttatataaaatagacaat
aaagctattttggatttaaatattcctactgcacaacccattatcttagatttcgataat
gaaaaaaatccaattaaatggcactatttaacataa

DBGET integrated database retrieval system