KEGG   Buchnera aphidicola APS (Acyrthosiphon pisum): BU304Help
Entry
BU304             CDS       T00036                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
buc  Buchnera aphidicola APS (Acyrthosiphon pisum)
Pathway
buc00010  Glycolysis / Gluconeogenesis
buc00260  Glycine, serine and threonine metabolism
buc00680  Methane metabolism
buc01100  Metabolic pathways
buc01110  Biosynthesis of secondary metabolites
buc01120  Microbial metabolism in diverse environments
buc01130  Biosynthesis of antibiotics
buc01200  Carbon metabolism
buc01230  Biosynthesis of amino acids
Module
buc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:buc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BU304 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BU304 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BU304 (gpmA)
Enzymes [BR:buc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BU304 (gpmA)
Membrane trafficking [BR:buc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BU304 (gpmA)
Exosome [BR:buc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BU304 (gpmA)
  Exosomal proteins of melanoma cells
   BU304 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 MAF_flag10
Motif
Other DBs
NCBI-GeneID: 1110003
NCBI-ProteinID: NP_240127
UniProt: P57390
Position
337248..337943
Genome map
AA seq 231 aa AA seqDB search
MKINQVVLIRHGQSEWNTLNKFTGWHDAELDKKGKDEAKFAAILLKKEKFFFDCAHTSLL
KRAIHTLQYILDELNQTWLSVKKSWRLNERHYGALEGLNKDEVIEKYGQKQVLLWRRSFD
ISPPQINIKDKRFPGNDPRYSHLNIHDIPLGESLEKTAKRVIPYWNKIVYPELKNNKKIL
IVAHGNSLRALIQHLYKIDNKAILDLNIPTAQPIILDFDNEKNPIKWHYLT
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaatcaagtagttttaattagacatggtcaaagcgaatggaatacattaaat
aaatttactggttggcatgatgctgaattagataaaaaaggaaaagatgaagctaaattt
gctgctatcttattaaaaaaagaaaaatttttttttgattgcgcacatacatcattatta
aaaagagcaattcatactttgcaatatattttagatgaattaaaccaaacctggttgtca
gttaaaaaatcctggcgtttaaacgaacgacattatggtgcattagaagggttaaataaa
gatgaagttattgagaaatatggacaaaaacaagttcttctatggagaagaagttttgat
attagtccacctcagattaatataaaagataaacgctttccaggaaacgatccacgctac
tctcatttaaatattcatgacatccctctaggagagagcttagaaaaaactgcaaaacga
gttattccttattggaacaaaattgtttatccagaattaaaaaataataaaaaaatactt
attgtagcgcatggaaattctttacgtgccttgatacaacacttatataaaatagacaat
aaagctattttggatttaaatattcctactgcacaacccattatcttagatttcgataat
gaaaaaaatccaattaaatggcactatttaacataa

DBGET integrated database retrieval system