KEGG   Buchnera aphidicola APS (Acyrthosiphon pisum): BU307Help
Entry
BU307             CDS       T00036                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
buc  Buchnera aphidicola APS (Acyrthosiphon pisum)
Pathway
buc00010  Glycolysis / Gluconeogenesis
buc00051  Fructose and mannose metabolism
buc00562  Inositol phosphate metabolism
buc01100  Metabolic pathways
buc01110  Biosynthesis of secondary metabolites
buc01120  Microbial metabolism in diverse environments
buc01130  Biosynthesis of antibiotics
buc01200  Carbon metabolism
buc01230  Biosynthesis of amino acids
Module
buc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:buc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BU307 (tpiA)
   00051 Fructose and mannose metabolism
    BU307 (tpiA)
   00562 Inositol phosphate metabolism
    BU307 (tpiA)
Enzymes [BR:buc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BU307 (tpiA)
Exosome [BR:buc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BU307 (tpiA)
  Exosomal proteins of bladder cancer cells
   BU307 (tpiA)
  Exosomal proteins of melanoma cells
   BU307 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 1110006
NCBI-ProteinID: NP_240130
UniProt: P57393
Position
complement(339955..340722)
Genome map
AA seq 255 aa AA seqDB search
MKKFFITANWKLNGNIKMISSFFKYLKLYSSSYLEKNTVIIAPPTIYLERVCKNISNMNI
FLGSQNVDINLNGAFTGETSILMLRDIGVKYVIIGHSERRFLHHETDDIIAKKFHLIKKS
NLTPILCVGETEIEKKHNQTEQVIQRQLNLILKNLGTSAFKNIIIAYEPIWAIGTGVSAD
PEHVQLIHVFIKNYILKYSSINRNDIIIQYGGSINHTNVKKFIEQPDINGLLIGNSSLSA
KEFLEIIKIAHEHYS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattcttcattacagctaactggaaattaaatggaaatataaaaatgatttct
agttttttcaaatatttaaaattatattcatcaagttatttagaaaaaaacactgttatt
attgctcctccaactatatatttagaacgagtatgtaaaaatataagcaatatgaacatt
tttcttggttcgcaaaacgtagatattaatttaaacggagcatttaccggtgaaacttct
attttgatgctgcgagatataggagtaaaatatgtgattatagggcattccgaaagacgt
tttttacatcatgaaactgatgatatcattgcaaaaaaatttcatttaattaaaaaatca
aatttaacacctatattgtgtgtaggtgaaacagaaatagaaaaaaaacataatcaaacc
gagcaggttattcaaagacaattaaatttgatattaaaaaatttaggcacatcagcattt
aaaaatataataattgcctatgaacctatttgggccatcggaactggtgtatcagcagat
ccagaacatgttcaactaatacatgtatttataaaaaattatattttaaaatatagctca
atcaatagaaatgatataataattcaatacggtggatctattaatcatactaatgtaaaa
aagtttattgaacaaccagacatcaatggtttattaattggaaattcatctttaagtgct
aaagaatttttagaaattataaaaatagcacacgaacactattcataa

DBGET integrated database retrieval system