KEGG   Buchnera aphidicola APS (Acyrthosiphon pisum): BU455Help
Entry
BU455             CDS       T00036                                 

Gene name
recD
Definition
(RefSeq) exodeoxyribonuclease V
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
buc  Buchnera aphidicola APS (Acyrthosiphon pisum)
Pathway
buc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:buc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BU455 (recD)
Enzymes [BR:buc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BU455 (recD)
DNA repair and recombination proteins [BR:buc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BU455 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_19 AAA_30 UvrD_C_2 AAA_11 Helicase_RecD Viral_helicase1 AAA_22 PhoH UvrD-helicase DUF2075 ABC_tran CbiA TrwB_AAD_bind AAA_28 FtsK_SpoIIIE AAA
Motif
Other DBs
NCBI-GeneID: 1109803
NCBI-ProteinID: NP_240267
UniProt: P57530
Position
500778..502586
Genome map
AA seq 602 aa AA seqDB search
MLILLKKAVKLKIIRPIDFYFSQFIAQKNNIVMLVAACVSYESSRGYISLPIKYFEKHYF
FSSSNEVFIKKILTLLEKKINWPVELLKHASIGNGGTSTPLVLHKKKIYLYKMWKSESNI
FNYLYTKNKKNKINQKKCSKILENLFPQKNMSFQKIAVALTLINNITFIIGGPGTGKTTT
ILKIIIALIKSSKKSIKIQLSAPTGKATTHLNEILKNNIFDLYFSEKEKCSLPSTATTIH
QLLGIQKISQKSFFNKSNCLDLDVLIIDEISMVDILMMEKILSSISKNTKLIFIGDHNQL
GPIESGSILRKICYYANDGYSFKSMISIEKLTQYKLCKKINKKTTNFISDNICVLNKNYR
FNKNSGIYTLSNAIFKKKTRIIESLFDNSIKNIFFYETNSSEQYKKMIKNICLNYEDFWE
KIYKKATMKEIIESFQNYQVLCILHDGLFGVNIINKKLEENMYKKNIIKYFYIDGEEWYI
GKPIMIINNNRALNVSNGNIGITNINKNGILQVSFLKENNTINNIPVKILRNYKTAWAIT
VHKSQGSEFMNTALILPNFNSHILNKDTLYTGITRSRKILSIFSDKKIFLNTIFKNTNKI
LF
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcttattttattaaaaaaagctgtaaaattgaaaattatacgtccaattgatttttat
ttttctcaatttatcgcacaaaaaaataatattgttatgttagttgctgcttgtgtaagt
tatgaaagcagtagaggttatatttctctgccaattaaatattttgaaaaacattatttt
ttttctagttcaaatgaagtatttataaaaaaaatattgactcttttagaaaaaaaaata
aattggcccgttgagttattaaaacatgcatctattggtaatggtggtacttctacacct
ttagttttacataaaaaaaaaatatatctctataaaatgtggaaatctgaaagtaatatt
tttaactatttatatacaaaaaataaaaaaaataaaattaatcaaaaaaaatgctcaaaa
atattggaaaatttgtttcctcaaaaaaatatgagttttcagaaaatagcggtagcatta
actttaataaataatataacatttattattggtgggcccggaactggaaaaactactact
atattgaaaataataattgcattaataaaaagttcaaaaaaatcaataaaaattcagtta
tctgcaccgacaggaaaagcgacaacacatttaaatgaaattctaaaaaacaatatcttt
gatctgtatttttctgaaaaagaaaagtgttctctaccatctacagctacaactatacat
caactattgggtattcaaaaaatatcacaaaaaagtttttttaataaaagtaactgttta
gatttagatgttttgattatcgatgaaatctcaatggtagacattttaatgatggaaaaa
atattatcttcaatttcaaaaaataccaagttaatttttataggagatcataatcaatta
ggtccaatagaatcaggttctattctaagaaaaatttgttattacgcaaatgatggatat
agctttaaatctatgattagtattgaaaaacttacacaatataaattgtgtaaaaaaata
aataaaaaaacaacaaactttattagtgataatatatgtgttttaaataaaaactacaga
tttaataaaaattcaggtatttatacgttgtctaatgctatttttaagaaaaaaactagg
atcattgaaagtctatttgataattcgataaaaaacatttttttttatgaaactaactct
tctgaacaatataaaaaaatgatcaaaaatatatgtttaaactatgaagatttttgggaa
aaaatatataaaaaagcgacaatgaaagaaataatagaatcttttcaaaattatcaagtt
ttgtgcatattgcatgatggtttatttggtgtgaatattataaataaaaagttagaagaa
aatatgtataaaaaaaatattataaaatatttttatattgatggagaagaatggtatata
gggaaacctattatgattattaataataatcgtgctctaaatgtatcaaatggaaatata
ggtattactaacatcaataaaaatggcattttacaagtatcttttttaaaagaaaacaat
acaattaataatattcctgtaaagatattaagaaattataaaactgcctgggctattact
gttcataaatcacaaggttcagaatttatgaatacagctttaatactacctaatttcaac
tctcatattttaaataaagacactttgtatactggtataacaagatctcgaaaaatatta
agtattttttcagataaaaaaatttttttaaatactatttttaaaaatacgaataaaata
ttattttaa

DBGET integrated database retrieval system