KEGG   Buchnera aphidicola APS (Acyrthosiphon pisum): BU455Help
Entry
BU455             CDS       T00036                                 

Gene name
recD
Definition
exodeoxyribonuclease V (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
buc  Buchnera aphidicola APS (Acyrthosiphon pisum)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:buc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BU455 (recD)
Enzymes [BR:buc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BU455 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
500778..502586
Genome map
AA seq 602 aa AA seqDB search
MLILLKKAVKLKIIRPIDFYFSQFIAQKNNIVMLVAACVSYESSRGYISLPIKYFEKHYF
FSSSNEVFIKKILTLLEKKINWPVELLKHASIGNGGTSTPLVLHKKKIYLYKMWKSESNI
FNYLYTKNKKNKINQKKCSKILENLFPQKNMSFQKIAVALTLINNITFIIGGPGTGKTTT
ILKIIIALIKSSKKSIKIQLSAPTGKATTHLNEILKNNIFDLYFSEKEKCSLPSTATTIH
QLLGIQKISQKSFFNKSNCLDLDVLIIDEISMVDILMMEKILSSISKNTKLIFIGDHNQL
GPIESGSILRKICYYANDGYSFKSMISIEKLTQYKLCKKINKKTTNFISDNICVLNKNYR
FNKNSGIYTLSNAIFKKKTRIIESLFDNSIKNIFFYETNSSEQYKKMIKNICLNYEDFWE
KIYKKATMKEIIESFQNYQVLCILHDGLFGVNIINKKLEENMYKKNIIKYFYIDGEEWYI
GKPIMIINNNRALNVSNGNIGITNINKNGILQVSFLKENNTINNIPVKILRNYKTAWAIT
VHKSQGSEFMNTALILPNFNSHILNKDTLYTGITRSRKILSIFSDKKIFLNTIFKNTNKI
LF
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcttattttattaaaaaaagctgtaaaattgaaaattatacgtccaattgatttttat
ttttctcaatttatcgcacaaaaaaataatattgttatgttagttgctgcttgtgtaagt
tatgaaagcagtagaggttatatttctctgccaattaaatattttgaaaaacattatttt
ttttctagttcaaatgaagtatttataaaaaaaatattgactcttttagaaaaaaaaata
aattggcccgttgagttattaaaacatgcatctattggtaatggtggtacttctacacct
ttagttttacataaaaaaaaaatatatctctataaaatgtggaaatctgaaagtaatatt
tttaactatttatatacaaaaaataaaaaaaataaaattaatcaaaaaaaatgctcaaaa
atattggaaaatttgtttcctcaaaaaaatatgagttttcagaaaatagcggtagcatta
actttaataaataatataacatttattattggtgggcccggaactggaaaaactactact
atattgaaaataataattgcattaataaaaagttcaaaaaaatcaataaaaattcagtta
tctgcaccgacaggaaaagcgacaacacatttaaatgaaattctaaaaaacaatatcttt
gatctgtatttttctgaaaaagaaaagtgttctctaccatctacagctacaactatacat
caactattgggtattcaaaaaatatcacaaaaaagtttttttaataaaagtaactgttta
gatttagatgttttgattatcgatgaaatctcaatggtagacattttaatgatggaaaaa
atattatcttcaatttcaaaaaataccaagttaatttttataggagatcataatcaatta
ggtccaatagaatcaggttctattctaagaaaaatttgttattacgcaaatgatggatat
agctttaaatctatgattagtattgaaaaacttacacaatataaattgtgtaaaaaaata
aataaaaaaacaacaaactttattagtgataatatatgtgttttaaataaaaactacaga
tttaataaaaattcaggtatttatacgttgtctaatgctatttttaagaaaaaaactagg
atcattgaaagtctatttgataattcgataaaaaacatttttttttatgaaactaactct
tctgaacaatataaaaaaatgatcaaaaatatatgtttaaactatgaagatttttgggaa
aaaatatataaaaaagcgacaatgaaagaaataatagaatcttttcaaaattatcaagtt
ttgtgcatattgcatgatggtttatttggtgtgaatattataaataaaaagttagaagaa
aatatgtataaaaaaaatattataaaatatttttatattgatggagaagaatggtatata
gggaaacctattatgattattaataataatcgtgctctaaatgtatcaaatggaaatata
ggtattactaacatcaataaaaatggcattttacaagtatcttttttaaaagaaaacaat
acaattaataatattcctgtaaagatattaagaaattataaaactgcctgggctattact
gttcataaatcacaaggttcagaatttatgaatacagctttaatactacctaatttcaac
tctcatattttaaataaagacactttgtatactggtataacaagatctcgaaaaatatta
agtattttttcagataaaaaaatttttttaaatactatttttaaaaatacgaataaaata
ttattttaa

DBGET integrated database retrieval system