KEGG   Burkholderia sp. RPE67: BRPE67_ACDS16550Help
Entry
BRPE67_ACDS16550  CDS       T03604                                 

Definition
(GenBank) acetyl-coA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bue  Burkholderia sp. RPE67
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:bue00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BRPE67_ACDS16550
   00630 Glyoxylate and dicarboxylate metabolism
    BRPE67_ACDS16550
   00640 Propanoate metabolism
    BRPE67_ACDS16550
   00650 Butanoate metabolism
    BRPE67_ACDS16550
  Lipid metabolism
   00071 Fatty acid degradation
    BRPE67_ACDS16550
   00072 Synthesis and degradation of ketone bodies
    BRPE67_ACDS16550
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BRPE67_ACDS16550
   00310 Lysine degradation
    BRPE67_ACDS16550
   00380 Tryptophan metabolism
    BRPE67_ACDS16550
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BRPE67_ACDS16550
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BRPE67_ACDS16550
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BRPE67_ACDS16550
Enzymes [BR:bue01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BRPE67_ACDS16550
Exosome [BR:bue04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRPE67_ACDS16550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:1790023..1791318
Genome map
AA seq 431 aa AA seqDB search
MREVRRVAIIGSNRIPFARSNTAYASASNQDMLSFALQGLVDRFDLHGLRLGEVAAGAVV
KHSRDFNLTREAALSTTLAKETPAYDVQQACGTGLETAILVANKIALGQIDAGIAGGVDT
ASDAPIAVNERMRKILLEANRGRSAGQRVGALAKLRPGMFFRPLLPRNAEPRTDLSMGEH
CELMAKRWKIAREAQDALAQDSHRKLAAAYGRGFFNDLMTPYKGLARDNNLRPDVSLDQL
SALTPVFDRDAGTLTAGNSTPLTDGASAVLLASEAWAAERGLPVQAFLTFSATAAVDFFD
KREGLLMAPAYAVPSMLARAGLALQDFDFYEIHEAFAAQVLCTLAAWEDEEYCRTALGLD
APLGSIDRARLNVNGGSLATGHPFGATGGRIVGTLAKMLAQAPARSDGTPLRGLISICAA
GGQGVVAILER
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagggaggttcgcagagtcgcgatcatcggcagcaaccgcattccgttcgcgcgctcg
aacacggcgtacgcgagcgcatcgaatcaggacatgctgagcttcgccctgcaggggctc
gtcgatcgcttcgacctgcatggcctgcgactcggcgaagtggcggcgggcgcggtcgtc
aagcattcgcgcgatttcaatctgacgcgcgaagccgcgctttcgaccacgctcgcgaag
gaaacgcccgcctacgatgtgcagcaggcttgcggcaccggcctcgagacggcgattctg
gtcgcgaacaagatcgcgctcgggcagatcgacgcgggcatcgcgggcggcgtcgatacc
gcctcggacgcgcccatcgccgtgaacgagcgcatgcgcaagatcctgctcgaagcgaat
cgcgggcgctcggcgggacaacgcgtcggcgcgctcgcgaagctgcgtcctggcatgttc
ttcaggccgctgttgccgcgcaatgccgaaccgcgcacggacctgtcgatgggcgagcac
tgcgaactgatggccaagcgctggaagatcgcgcgcgaggcgcaggacgcgctcgctcag
gacagtcatcgcaagctcgcggcggcctacgggcgcggcttcttcaacgatctgatgacg
ccgtacaaaggactcgcgcgcgacaacaacctgcgtcccgacgtttcgctcgaccagctt
tccgcgctgacgcccgtcttcgaccgcgacgccggcacgctcaccgcgggcaattcgacg
ccgcttaccgacggcgcgtccgccgtgctgcttgcctccgaagcatgggccgccgaacgc
gggctgccggtgcaggcgttcctgacgttttccgcgaccgcggccgtcgatttcttcgac
aagcgtgaaggcctgctgatggcgcccgcctacgcggtcccatcgatgctcgcgcgcgcc
gggctcgccttgcaggacttcgacttctacgaaattcacgaagcgttcgcggcgcaagtg
ctgtgcacgctggccgcgtgggaagacgaggaatactgccgcaccgcgctcggcctcgac
gcgcctttaggttccatcgaccgcgcgcgcctgaacgtgaacggcggctcgctcgcgacg
ggccatccgttcggggcgacgggcggacgtatcgtcggcacgctggcgaagatgctcgcg
caggcgccagcacgcagcgacggcacaccgctgcgcggactgatctcgatttgcgcggcg
ggcggccagggcgtcgtcgcgatactggagcggtag

DBGET integrated database retrieval system