KEGG   Burkholderia sp. CCGE1001: BC1001_0242Help
Entry
BC1001_0242       CDS       T01424                                 

Definition
ATP-binding region ATPase domain-containing protein
Orthology
K10125  
two-component system, NtrC family, C4-dicarboxylate transport sensor histidine kinase DctB [EC:2.7.13.3]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Two-component system
Module
DctB-DctD (C4-dicarboxylate transport) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bug00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BC1001_0242
Enzymes [BR:bug01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BC1001_0242
Protein kinases [BR:bug01001]
 Histidine protein kinases
  NtrC family
   BC1001_0242
Two-component system [BR:bug02022]
 NtrC family
  DctB-DctD
   BC1001_0242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:270193..272193
Genome map
AA seq 666 aa AA seqDB search
MQPVTARPNPMPPAGEARADGASPYATISDHTRPDIANVTRRLLILFALVAGLAAACGLT
YSIAWQSGIDSLRLNAAGRVDRTTSSLKSTLERYESLPYLLAEHPIVQDVLVDPSPANVE
RANLYLEDLNRHARATVTYIIPLDGYCVAASNWQGPGSFIGAGYQFRPYFVDAVKGGVGR
FFGIGTISQAPGYYISQPVRRDGKIVGVAVVKLDLEWFQGADASEPLLVTDDHGVIFLSS
VPAWKYHTIRPLSGQVADSIYQARQYAQQPIAPLPVTIERKLDGDAQIVRVGGGRYAPRY
LASRRGMGVPDWHLITMAPVSPVDADARNATIVTGFGYVSLVLLAFYWRMRRARVREVMR
SRALLQKAYAELNQRVAERTADLSQANEQLQKEVAERTRAEQELRAAHDELIQASKLAAL
GQMAAGITHELNQPLAALRGFSDNTRVLLERGDQASARENLEAIAALTERMGKITNQLKL
FVGRARPRSARAPAVRALRNAVALLQKRLQGVELELALSDAQSGARAPLDLADDHPELIV
HCDDLRLEQVLINLLGNALDATAGSGAPRISVHIEVAADSLSFAVSDNGPGIPEDVLPRL
FEPFFTTKEMGQGLGLGLAISSSIARDCGGTLVARNAPQGGALFVLTLRRARAQTSPAAD
SLATGS
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccggtgaccgcgcgcccaaacccaatgccgccggccggggaagctcgcgccgac
ggcgcttcgccttatgccacaatatccgatcacacccgaccggatattgccaacgtgacc
cgccgcctgctgatcctcttcgcgctcgtcgccgggctcgcggcggcgtgcgggctcact
tacagcatcgcgtggcaaagcgggatcgacagcttgcggctcaatgcggccgggcgcgtc
gaccgcaccaccagctcgctgaaaagcacgctcgagcgctatgagtcgctgccgtatctg
ctcgcggaacatcctatcgtgcaggatgtgctggtcgatccgtcgccggccaacgtggag
cgcgcgaatctctatctcgaagacctgaaccgccacgcgcgcgccaccgtcacctacatc
attccgctcgacggctactgcgtagccgcgagcaactggcaaggcccgggcagtttcatc
ggcgcgggctatcagttccggccgtatttcgtcgacgcggtcaagggcggcgtgggccgc
ttcttcggcatcggcacgatctcgcaggcgccgggctactacatttcgcagccggtgcgg
cgcgacggcaagattgtcggcgtggccgtcgtcaaactcgatctcgaatggtttcagggc
gccgacgcgtccgagccgctgctcgtcaccgacgaccacggcgtgatctttctttcgtcg
gtgcccgcctggaaataccacacgatacgaccgctctccgggcaggtcgccgattccatc
taccaggcgcgtcaatacgcgcagcagccgatcgcgccgctgccggtcacgatcgagcgc
aagctggacggcgacgcgcagatcgtgcgcgtgggcggcggccgctacgcgccgcgctac
ctcgcgtcgcggcgcggcatgggcgtaccggactggcatctgatcaccatggcgccggtg
agtcccgtggacgccgacgcgcgcaacgcgaccatcgtgaccggcttcggctatgtgtcg
ctcgtgctgctcgccttctactggagaatgcgccgcgcgcgcgtgcgcgaagtgatgcgc
agccgcgcgctgctgcaaaaggcgtatgcggagctgaaccagcgcgttgccgaacgtacc
gcggacctctcgcaggcaaacgagcagttgcaaaaagaggtcgccgaacgcacgcgcgcc
gagcaggaactgcgcgccgcgcacgacgagctgatccaggcaagcaagctcgccgcgctc
ggccagatggcggccggcatcacgcatgaactgaatcagccgctcgccgcgctgcgcggc
ttttccgacaacacgcgcgtgctgctcgagcggggtgaccaggcgtcggcgcgtgagaat
ctggaagcgattgccgcgctcaccgagcgcatgggcaagatcaccaatcagctgaagctg
tttgttggacgggcgcggccgcgcagcgcgcgtgcgccggccgtgcgcgcgctgcgcaac
gccgtcgcgttgctgcaaaagcgcctgcagggcgtcgagctggagcttgcgctgtccgat
gcgcaaagcggcgcgcgcgcgccgctcgaccttgccgacgatcatcccgagctgatcgtt
cattgcgacgacctgcgtctcgaacaggtgctcatcaatctgctcggcaatgcgctcgac
gcgaccgcgggcagcggcgcgccgcgcatttcggtccacatcgaggtcgccgcggacagc
ctgtctttcgcggtaagcgacaacggcccgggcattcccgaagatgtcttgccgcgcctg
ttcgaaccgtttttcaccaccaaggaaatgggccagggcctcggcctcgggctcgccatt
tcgtcgtcgatcgcgcgggactgcggcggcacgctcgtggcgcgcaatgcgccgcaaggc
ggtgcattatttgtgttgacgctgcgccgcgcccgcgcgcagacgagccctgccgcggac
tcgctcgcgacgggttcctga

DBGET integrated database retrieval system