KEGG   Burkholderia sp. CCGE1001: BC1001_0250Help
Entry
BC1001_0250       CDS       T01424                                 

Definition
glutamate/cysteine ligase
Orthology
K01919  
glutamate--cysteine ligase [EC:6.3.2.2]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Glutathione metabolism
Metabolic pathways
Module
Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BC1001_0250
Enzymes [BR:bug01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.2  glutamate---cysteine ligase
     BC1001_0250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:280064..281353
Genome map
AA seq 429 aa AA seqDB search
MVPHLVTALNGPLLDLERKILDATPAIERWFRLEWQEHTPPFYCSVDLRNAGFKLAPVDT
NLFPGAFNNLPQEVLPLAVQAAMASIEKICPDAKNLLVIPERHTRNAFYLENVARLAAIM
RQAGLNVRFGTLDESINGPVTIALSDGQKLVLEPLERSQRRLGLKNFDPCSILLNNDLSG
GIPPVLENLHEQYLLPPLHAGWAVRRKSTHFSCYDDVAKKFAKMVEIDPWMINPYFAHVE
GVDFQERTGEEALADAIDGVLKKIAKKYREYGISEKPYVVIKSDAGTYGMGVMTVHDASE
VAALTKRERAKMAATKDGLEVHDVIVQEGVYTFERIGEEVAEPVVYMIDRYVVGGFYRVH
GSRERDQNLNAPGMHFVPLGFEHTALPDAHAKPGAAPPNRFYMYGVVARLGLLAASVELE
KTDPEAIQV
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggttccgcacctagttacggcgttaaacggcccgctgctcgatctcgagcggaagatc
ctcgacgctacgcccgccatcgaacgctggttccggctcgagtggcaggagcacacgccg
cctttctactgttccgtcgacttgcgcaacgcgggtttcaagcttgcgcccgtcgacacc
aatctgtttcccggcgcattcaataatctgccgcaggaagtgctgccgctcgccgtgcag
gccgccatggcgtccatcgaaaagatctgcccggacgcgaagaatctgctcgtcattccc
gagcgccacacgcgcaacgcgttctatctggagaacgtggcccggctcgcggcgatcatg
cgccaggccggcctgaacgtgcgtttcggcacgctcgacgaaagcatcaacggacctgtc
accattgcgctgtccgacggccagaagctcgtgctcgaaccgctcgagcgctcgcagcgg
cgcctcgggctcaagaatttcgacccgtgctcgattctgctgaataacgatttgtcgggc
ggcattccgcccgtgctcgagaatctgcacgagcagtatctgctgccgccgctgcacgcg
ggctgggcggttcgccgcaaatcgacgcatttctcgtgttatgacgacgtggcgaagaag
ttcgcgaagatggtcgagatcgatccgtggatgatcaacccgtacttcgcgcatgtcgaa
ggcgtggattttcaggagcgcaccggcgaagaagcgctggccgacgcgatcgacggcgtg
ctgaagaagattgcgaagaagtatcgcgagtacggcatctccgaaaaaccgtatgtcgtc
atcaaatccgatgcgggcacttatggcatgggcgtcatgacggtgcacgacgcgtcggaa
gtcgcggcgctcaccaagcgcgagcgggcgaagatggcggctacgaaggacggcctcgaa
gtgcacgacgtgatcgtccaggaaggcgtgtacacgttcgagcgcatcggcgaggaagtg
gccgagccggtcgtctacatgatcgaccgctatgtggtgggcggcttctaccgcgtgcac
ggcagccgtgagcgcgatcagaacctcaacgcgcccggcatgcacttcgtgccgctcggc
ttcgagcacacggcgctgccggacgcgcacgcgaagccgggcgcggcgccgccgaaccgc
ttctatatgtacggcgtggtggcgcggctcggtttgctggccgcctcggtcgaactggaa
aagaccgatccggaagcgatccaggtctaa

DBGET integrated database retrieval system