KEGG   Burkholderia sp. CCGE1001: BC1001_0457Help
Entry
BC1001_0457       CDS       T01424                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BC1001_0457
Enzymes [BR:bug01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BC1001_0457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(507209..507742)
Genome map
AA seq 177 aa AA seqDB search
MTVAYLGLGANLGDARQTLKDAVVCLAQQHTITVLAKSSLYRTAPIDAGGDDYFNCVVKL
DTTLPVRHLLALCHKIEHQFGRERPFRNAPRTLDLDILLYGDQSIDEADLIVPHPRLVER
AFALVPLVEIDAALVIPRHGRADALLEGVREQRIEKVKGPCQCPTLNALNAGKGRCE
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgacggttgcttatctcggcttgggcgcgaatctcggggacgcgcgccagaccctgaaa
gacgcggtggtgtgcctcgcacaacagcacaccatcaccgtgctcgccaagtcgagcctg
tatcgcactgccccgatcgacgcgggcggtgacgactatttcaactgcgtggtgaagctc
gacacgacgctccccgtgcgccatctgctcgcgctgtgccataagatcgagcatcagttc
ggccgggagcggccctttcggaacgcgccgcgaacgctcgatctggacatcctgctctac
ggcgatcaatccatcgacgaagccgatctgatcgttccgcatccccgccttgtcgaacgc
gcgtttgcgctggtgccgctcgtcgagatcgacgccgcgctggtcattccgcggcacggc
cgcgccgacgcgctgctcgagggcgtgcgcgagcagcgcatcgaaaaagtcaaagggccg
tgccagtgcccgacgctcaatgcactcaacgccggcaagggccgctgcgaatga

DBGET integrated database retrieval system