KEGG   Burkholderia sp. CCGE1001: BC1001_0629Help
Entry
BC1001_0629       CDS       T01424                                 

Definition
(RefSeq) pyridoxal-5'-phosphate-dependent protein subunit beta
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BC1001_0629
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BC1001_0629
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BC1001_0629
Enzymes [BR:bug01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BC1001_0629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:692162..693319
Genome map
AA seq 385 aa AA seqDB search
MKSHYVEPLSGTTYPLDTPRWCSDDRRPLLISPLAGISRDDIDRHLRSQWRYRASLPVEI
VSPISMGEGCTPLVQKAWGEHRPHFKLEWFSPTSSFKDRGTTVMLSMLRQQGVTSVLEDS
SGNGGASVAAYGAAGAMRVKILAPAYASPAKIAQMRAYGAEVQLVDGPRQACEDEAVRQS
ASIFYASHNWQPFFLEGTKSVGYEIWEDLNFQAPDNIVMPAGAGSNVLGCYLAFSELMRA
GQISKMPRLFVCQPLNCSPIDASFQAGVTTPVAREVRKTVSEGTAIAHPLRLAQVVNAVR
ETGGTTVAVEEEAIVEALRRIARLGLLPELTSATAVAGFDRLTRVGAIQAREETVVLLTG
TGIKNAEAIAHMYSDTPKPLSKGSI
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatcgcactatgtcgagccgctcagcggcaccacctatcctttagatacgccccgg
tggtgttcggacgaccgcagaccgctcctgatctcgccgctggctggaatttcccgtgac
gacatcgaccggcaccttcgttcgcaatggcgctatcgggcatcgcttccagtcgagatc
gtgtcgcccatctccatgggggaaggctgcacgccgcttgtgcagaaggcatggggcgag
caccggccgcatttcaagctggagtggttcagccccaccagcagcttcaaggatcgcggc
accacggtgatgctgtcgatgttacggcaacaaggcgtcacgtctgtgctggaagacagc
tcgggcaacggcggagcgtcggtggccgcatatggcgctgcgggcgcaatgcgcgtgaag
attctggcgcccgcctacgcgtcgcccgcaaagatcgcccagatgcgcgcctacggggcg
gaggtgcaactggtcgacggaccccgacaggcgtgtgaagacgaggcagtccggcagtcc
gcgagcattttctacgcgagccacaattggcagccgtttttcctcgaagggaccaagtcg
gtcggctacgagatctgggaggacctcaacttccaggcgccggacaacatcgttatgcct
gcaggcgcgggcagcaatgtactcggctgctatctggcgttctcggaactgatgcgcgcg
ggccagatcagcaagatgcccaggcttttcgtttgccagccattgaactgctcgcccatc
gatgccagctttcaggccggcgtcacgacgcccgttgcgcgtgaggttcggaagaccgtc
tccgaggggacggccatcgcccatcctctgcggctcgcgcaggtggtcaacgctgtcaga
gagacgggcggcacgacggtcgctgtggaagaagaggcaatcgtcgaagcactcaggcgg
attgcgcgactaggtcttctgccggagctgacctcggcgactgcggttgccggatttgat
cggcttactcgagtcggggcgattcaggcgcgagaggagacggttgtcctcttgacgggc
acgggcatcaaaaacgccgaagctattgcgcatatgtactcggacactcccaagcccttg
tctaaaggctcaatctga

DBGET integrated database retrieval system