KEGG   Burkholderia sp. CCGE1001: BC1001_0629Help
Entry
BC1001_0629       CDS       T01424                                 

Definition
pyridoxal-5'-phosphate-dependent protein subunit beta
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BC1001_0629
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BC1001_0629
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BC1001_0629
Enzymes [BR:bug01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BC1001_0629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:692162..693319
Genome map
AA seq 385 aa AA seqDB search
MKSHYVEPLSGTTYPLDTPRWCSDDRRPLLISPLAGISRDDIDRHLRSQWRYRASLPVEI
VSPISMGEGCTPLVQKAWGEHRPHFKLEWFSPTSSFKDRGTTVMLSMLRQQGVTSVLEDS
SGNGGASVAAYGAAGAMRVKILAPAYASPAKIAQMRAYGAEVQLVDGPRQACEDEAVRQS
ASIFYASHNWQPFFLEGTKSVGYEIWEDLNFQAPDNIVMPAGAGSNVLGCYLAFSELMRA
GQISKMPRLFVCQPLNCSPIDASFQAGVTTPVAREVRKTVSEGTAIAHPLRLAQVVNAVR
ETGGTTVAVEEEAIVEALRRIARLGLLPELTSATAVAGFDRLTRVGAIQAREETVVLLTG
TGIKNAEAIAHMYSDTPKPLSKGSI
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatcgcactatgtcgagccgctcagcggcaccacctatcctttagatacgccccgg
tggtgttcggacgaccgcagaccgctcctgatctcgccgctggctggaatttcccgtgac
gacatcgaccggcaccttcgttcgcaatggcgctatcgggcatcgcttccagtcgagatc
gtgtcgcccatctccatgggggaaggctgcacgccgcttgtgcagaaggcatggggcgag
caccggccgcatttcaagctggagtggttcagccccaccagcagcttcaaggatcgcggc
accacggtgatgctgtcgatgttacggcaacaaggcgtcacgtctgtgctggaagacagc
tcgggcaacggcggagcgtcggtggccgcatatggcgctgcgggcgcaatgcgcgtgaag
attctggcgcccgcctacgcgtcgcccgcaaagatcgcccagatgcgcgcctacggggcg
gaggtgcaactggtcgacggaccccgacaggcgtgtgaagacgaggcagtccggcagtcc
gcgagcattttctacgcgagccacaattggcagccgtttttcctcgaagggaccaagtcg
gtcggctacgagatctgggaggacctcaacttccaggcgccggacaacatcgttatgcct
gcaggcgcgggcagcaatgtactcggctgctatctggcgttctcggaactgatgcgcgcg
ggccagatcagcaagatgcccaggcttttcgtttgccagccattgaactgctcgcccatc
gatgccagctttcaggccggcgtcacgacgcccgttgcgcgtgaggttcggaagaccgtc
tccgaggggacggccatcgcccatcctctgcggctcgcgcaggtggtcaacgctgtcaga
gagacgggcggcacgacggtcgctgtggaagaagaggcaatcgtcgaagcactcaggcgg
attgcgcgactaggtcttctgccggagctgacctcggcgactgcggttgccggatttgat
cggcttactcgagtcggggcgattcaggcgcgagaggagacggttgtcctcttgacgggc
acgggcatcaaaaacgccgaagctattgcgcatatgtactcggacactcccaagcccttg
tctaaaggctcaatctga

DBGET integrated database retrieval system