KEGG   Burkholderia sp. CCGE1001: BC1001_0629Help
Entry
BC1001_0629       CDS       T01424                                 

Definition
(GenBank) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00260  Glycine, serine and threonine metabolism
bug00750  Vitamin B6 metabolism
bug01100  Metabolic pathways
bug01110  Biosynthesis of secondary metabolites
bug01120  Microbial metabolism in diverse environments
bug01230  Biosynthesis of amino acids
Module
bug_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BC1001_0629
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BC1001_0629
Enzymes [BR:bug01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BC1001_0629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADX54084
JGI: BC1001_0629
UniProt: E8YPI4
Position
1:692162..693319
Genome map
AA seq 385 aa AA seqDB search
MKSHYVEPLSGTTYPLDTPRWCSDDRRPLLISPLAGISRDDIDRHLRSQWRYRASLPVEI
VSPISMGEGCTPLVQKAWGEHRPHFKLEWFSPTSSFKDRGTTVMLSMLRQQGVTSVLEDS
SGNGGASVAAYGAAGAMRVKILAPAYASPAKIAQMRAYGAEVQLVDGPRQACEDEAVRQS
ASIFYASHNWQPFFLEGTKSVGYEIWEDLNFQAPDNIVMPAGAGSNVLGCYLAFSELMRA
GQISKMPRLFVCQPLNCSPIDASFQAGVTTPVAREVRKTVSEGTAIAHPLRLAQVVNAVR
ETGGTTVAVEEEAIVEALRRIARLGLLPELTSATAVAGFDRLTRVGAIQAREETVVLLTG
TGIKNAEAIAHMYSDTPKPLSKGSI
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatcgcactatgtcgagccgctcagcggcaccacctatcctttagatacgccccgg
tggtgttcggacgaccgcagaccgctcctgatctcgccgctggctggaatttcccgtgac
gacatcgaccggcaccttcgttcgcaatggcgctatcgggcatcgcttccagtcgagatc
gtgtcgcccatctccatgggggaaggctgcacgccgcttgtgcagaaggcatggggcgag
caccggccgcatttcaagctggagtggttcagccccaccagcagcttcaaggatcgcggc
accacggtgatgctgtcgatgttacggcaacaaggcgtcacgtctgtgctggaagacagc
tcgggcaacggcggagcgtcggtggccgcatatggcgctgcgggcgcaatgcgcgtgaag
attctggcgcccgcctacgcgtcgcccgcaaagatcgcccagatgcgcgcctacggggcg
gaggtgcaactggtcgacggaccccgacaggcgtgtgaagacgaggcagtccggcagtcc
gcgagcattttctacgcgagccacaattggcagccgtttttcctcgaagggaccaagtcg
gtcggctacgagatctgggaggacctcaacttccaggcgccggacaacatcgttatgcct
gcaggcgcgggcagcaatgtactcggctgctatctggcgttctcggaactgatgcgcgcg
ggccagatcagcaagatgcccaggcttttcgtttgccagccattgaactgctcgcccatc
gatgccagctttcaggccggcgtcacgacgcccgttgcgcgtgaggttcggaagaccgtc
tccgaggggacggccatcgcccatcctctgcggctcgcgcaggtggtcaacgctgtcaga
gagacgggcggcacgacggtcgctgtggaagaagaggcaatcgtcgaagcactcaggcgg
attgcgcgactaggtcttctgccggagctgacctcggcgactgcggttgccggatttgat
cggcttactcgagtcggggcgattcaggcgcgagaggagacggttgtcctcttgacgggc
acgggcatcaaaaacgccgaagctattgcgcatatgtactcggacactcccaagcccttg
tctaaaggctcaatctga

DBGET integrated database retrieval system