KEGG   Burkholderia sp. CCGE1001: BC1001_0692Help
Entry
BC1001_0692       CDS       T01424                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00010  Glycolysis / Gluconeogenesis
bug00030  Pentose phosphate pathway
bug00051  Fructose and mannose metabolism
bug00052  Galactose metabolism
bug00230  Purine metabolism
bug00500  Starch and sucrose metabolism
bug00520  Amino sugar and nucleotide sugar metabolism
bug00521  Streptomycin biosynthesis
bug01100  Metabolic pathways
bug01110  Biosynthesis of secondary metabolites
bug01120  Microbial metabolism in diverse environments
bug01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1001_0692
   00030 Pentose phosphate pathway
    BC1001_0692
   00051 Fructose and mannose metabolism
    BC1001_0692
   00052 Galactose metabolism
    BC1001_0692
   00500 Starch and sucrose metabolism
    BC1001_0692
   00520 Amino sugar and nucleotide sugar metabolism
    BC1001_0692
  Nucleotide metabolism
   00230 Purine metabolism
    BC1001_0692
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BC1001_0692
Enzymes [BR:bug01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BC1001_0692
    5.4.2.8  phosphomannomutase
     BC1001_0692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADX54146
JGI: BC1001_0692
UniProt: E8YF02
Position
1:771967..773361
Genome map
AA seq 464 aa AA seqDB search
MISKSIFKAYDIRGVIGKTLDADAARSIGRAFGSEVRAQGGDAVVVARDGRLSGPELIQA
LSDGLRAAGVDVVNVGMVPTPVGYFAASVPLQLEGGERRVDSCIVVTGSHNPPDYNGFKM
VLRGSAIYGEQIQALHQRIVDEKFSEGSGTYVEYDIADDYLQRIASDVKLARPIKIVVDT
GNGVAGGLAPQLFRKLGCELVELFTEIDGNFPNHHPDPAHPENLQDVIRALKETDAEIGF
AFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNKGAQIIYDVKCTRNLAKWVKDKGG
EPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLEILTRVDDP
SKLLNSLPNSHSTPELQLKLEEGENFELIARLQKNAQFTGADDVVTIDGLRVEYPDGFGL
ARSSNTTPVVVMRFEADNDAALKRIQEDFRRVILAEKADAKLPF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatctccaaatccattttcaaggcgtatgacattcgcggtgtgatcggcaagacgctc
gacgccgacgcagcgcgttcgatcggccgcgcgttcggcagcgaagtgcgtgcgcagggc
ggcgacgcggtggtggtcgcgcgcgacggccgtctgtcggggccggagttgatccaggcc
ttgtcggatggcctgcgtgcggccggcgtcgacgtggtgaatgtcggcatggtgcctacg
cccgtcggttatttcgcggcaagcgtgccgttgcagctcgagggcggcgagcgccgcgtc
gattcgtgcatcgtcgtgacgggtagtcataatccgccggattacaacggcttcaagatg
gtgctgcgcggctccgcgatttacggcgagcagattcaggcgctgcatcagcgcatcgtc
gacgaaaaattttctgagggcagcggcacgtacgtcgagtacgacattgccgacgattat
ctccagcgcattgcgagcgacgtaaagctcgcgcgtcccatcaagatcgtggtcgacacg
ggcaacggcgttgcgggcggcctcgcgccccagctcttcaggaagctcggttgcgaactc
gtcgagctcttcacggagatcgacggcaacttcccgaaccaccatccggacccggcgcac
ccggaaaaccttcaggacgtgattcgcgcgctgaaggaaacggacgcggaaatcggcttc
gcattcgacggcgacggcgaccgcctcggcgtcgtcacgaaagacggccagatcatttat
ccggaccgccagctcatgctcttcgccgaagaagtgctgtcgcgcaacaagggcgcgcag
atcatttacgacgtgaagtgcacgcgcaatctcgcgaagtgggtgaaagacaagggcggc
gagccgctcatgtggaagaccggccactcgctcgtgaaagcgaagctgcgcgaaaccggc
gcgccgctcgcgggcgaaatgagcggccacgtgttcttcaaggaccgctggtatggtttc
gacgacggcctctacaccggcgcgcgtctgctcgaaatcctcacgcgcgtggatgacccg
agcaagctgctgaactcgctgcccaattcgcactccacgcccgagctgcaactgaagctg
gaagaaggcgagaacttcgagctcatcgcacgtctgcagaaaaatgcgcaattcaccggc
gcggacgacgtcgtgaccatcgacggcctgcgcgtcgagtacccggatggcttcggcctc
gcgcgctcgtcgaacaccacgccggtcgtggtcatgcgtttcgaggccgataacgacgcg
gcgctcaagcgcatccaggaagacttccgccgcgtgattctcgcggagaaggcggacgcg
aagctgccgttctga

DBGET integrated database retrieval system