KEGG   Burkholderia sp. CCGE1001: BC1001_0719Help
Entry
BC1001_0719       CDS       T01424                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bug  Burkholderia sp. CCGE1001
Brite
Enzymes [BR:bug01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BC1001_0719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 MTS Methyltransf_11 Methyltransf_23 PrmA RrnaAD Methyltransf_12 Met_10 Ubie_methyltran Methyltransf_18 Methyltransf_32 ADH_zinc_N DUF938 Methyltransf_16 Methyltransf_24 Methyltransf_3 tRNA_U5-meth_tr UPF0146 Cons_hypoth95 Methyltransf_4 MetW Methyltransf_9 CMAS MethyltransfD12
Motif
Other DBs
NCBI-ProteinID: ADX54173
JGI: BC1001_0719
UniProt: E8YF29
Position
1:complement(797529..798182)
Genome map
AA seq 217 aa AA seqDB search
MNIEQARFNMIEQQIRPWEVLDQDVLNLLSIVKRENFVPAAYRELAFADFEVPLPAGQHM
LAPRVEARVLQELAVKKHESVLEIGAGSGYMAALLAHRAQHVLTVDIEPELAELAKTNLI
ANGVLNVEVATGDAARGWAAAAPYDVICVSGGLPVLPQDILEHLKIGGRLAAFVGTAPVM
KAQIITRIDEKQYRIADVFETYVEPLVNAVQPPRFKF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgagcaagcgcgtttcaacatgatcgaacagcagatccgcccctgggaagtg
ctcgaccaggacgtgctgaatctgctgtcgatcgtcaagcgtgagaacttcgtccccgcc
gcgtaccgcgaactggctttcgccgacttcgaagtgccgctgccggccggccagcacatg
ctggcgccgcgcgtcgaggcgcgcgtgctgcaggaactggcggtgaagaagcacgaaagc
gtgctcgaaatcggcgccggctcgggttatatggcggcgttgctcgcgcatcgcgcgcaa
catgtgctgacggtagacatcgaaccggaactggcggaactggccaagaccaacctcatc
gccaacggcgtgctcaacgtggaagtcgccaccggcgacgccgcgcgcggctgggccgcc
gccgcaccgtatgacgtgatctgcgtgtcgggcggcctgcccgtgctgccgcaggacatt
ctggagcatctgaaaatcggcggccgtctggcggcgttcgtcggcacggcgccggtcatg
aaggcgcagatcatcacgcgcatcgacgaaaagcagtaccgcattgccgacgtgttcgaa
acgtatgtcgagccgctcgtcaacgccgtgcagccgccgcgcttcaagttctga

DBGET integrated database retrieval system