KEGG   Burkholderia sp. CCGE1001: BC1001_0745Help
Entry
BC1001_0745       CDS       T01424                                 

Definition
(GenBank) DNA polymerase III chi subunit HolC
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00230  Purine metabolism
bug00240  Pyrimidine metabolism
bug01100  Metabolic pathways
bug03030  DNA replication
bug03430  Mismatch repair
bug03440  Homologous recombination
Module
bug_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BC1001_0745
   00240 Pyrimidine metabolism
    BC1001_0745
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BC1001_0745
   03430 Mismatch repair
    BC1001_0745
   03440 Homologous recombination
    BC1001_0745
Enzymes [BR:bug01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BC1001_0745
DNA replication proteins [BR:bug03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     BC1001_0745
DNA repair and recombination proteins [BR:bug03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     BC1001_0745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: ADX54199
JGI: BC1001_0745
UniProt: E8YFK4
Position
1:829230..829646
Genome map
AA seq 138 aa AA seqDB search
MTRIDFHSNVGDSLLYACRLARKAYQAGQPTIVVAEPERLQAFDEQLWTFSALDFVPHCM
AGTPLAAHTPIVLAANLDDVPHHQVLLNLGASVPAQFARFERLLEVVGNAHDELIAGRER
YRFYRDRGYALNNYKQGG
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgactcgaatcgatttccactcgaacgtcggcgactcgctgctgtatgcgtgccgcctc
gcgcgcaaggcataccaggcggggcagcccaccatcgtcgtcgcggagccggagcggctg
caagcgttcgacgagcagttgtggaccttttcggcgctcgacttcgtgccgcactgcatg
gcgggcacgccgctcgcggcacacacgccgatcgtgctcgctgcgaatctcgacgacgtt
ccgcatcaccaggtgctgctcaatctgggcgcaagtgtgcccgcgcaattcgcgcgcttc
gaaagattgctcgaagtggtcggtaacgcacatgacgagctcatcgccggccgcgagcgc
taccgtttctatcgcgatcgcggctatgctttgaacaactacaagcagggcggctag

DBGET integrated database retrieval system