KEGG   Burkholderia sp. CCGE1001: BC1001_0763Help
Entry
BC1001_0763       CDS       T01424                                 

Definition
cobalamin biosynthesis protein CobD
Orthology
K02227  
adenosylcobinamide-phosphate synthase [EC:6.3.1.10]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Module
Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BC1001_0763
Enzymes [BR:bug01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.10  adenosylcobinamide-phosphate synthase
     BC1001_0763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(846932..847867)
Genome map
AA seq 311 aa AA seqDB search
MLSLPLIVTLATAGVAVDRWIGEPRGAHPLVGFGKWAARLEAHYNRGRRLRLKGLLAWAL
AVLPPVLAASWLVAVLPFFAACAVHVALLWFALGARSLHDHIEPIAQALAQRDLAQARLL
TSRIVSRETAHADEAALSRAAVESALENGNDAIFGALFWFAIAGGPGALGFRLANTLDAM
WGYRTPRYLRFGWAAARLDDVLNWIPARLTAASYALLGDTRTAWRCWREQAPRWDSPNAG
PVMASGAGSLNVLIGGPAVYHGALEHRPTLGFGHPAKAAHITAALMLVERTVILWLAVLI
VLALLSVPLHV
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcgcttccactcatcgtgacgttggcaacggcgggcgtggccgtcgaccgttgg
atcggcgagccgcgcggcgcgcatccgctcgtcggcttcggcaaatgggcggcgcgcctc
gaagcacactacaaccgcggccggcgcctgcggctgaagggcttgctggcctgggcgcta
gccgtgctgccgccggtgctcgctgcctcgtggctcgtggccgtgctgccgttttttgcg
gcctgcgccgtccacgtcgcgctgctgtggttcgcgctcggcgcacgcagtctgcacgac
catatcgagccgattgcgcaggcgctcgcgcagcgcgacctcgcgcaggcgcgcctcttg
acctcacgcatcgtctcgcgcgaaaccgcgcatgccgacgaagccgccctgtcgcgcgcc
gcggtcgaatcggcgctggaaaacggcaacgacgccattttcggcgccctcttctggttt
gcaattgcgggcgggccgggtgcgctcggctttcgcctcgccaatacgctcgatgcgatg
tggggttatcgcacgccgcgctatctacgcttcggctgggccgccgcgcgcctcgacgac
gtgctcaactggattcccgcgcgcctcaccgccgcgagctacgcgctgctcggcgacacg
cgcaccgcgtggcgctgctggcgcgagcaggcgccgcggtgggacagtccgaatgccggg
ccggtgatggcctcgggcgcgggcagcctgaatgtgctgatcggcggcccggcggtgtat
cacggcgcgctcgaacatcggcccacgctcggcttcggccatcccgcaaaggccgcgcat
atcacggccgcgctgatgctggtcgagcgcaccgtcattctgtggcttgcggtactgatc
gtgctggccttgctgagcgtgccgctgcatgtctga

DBGET integrated database retrieval system