KEGG   Burkholderia sp. CCGE1001: BC1001_0763Help
Entry
BC1001_0763       CDS       T01424                                 

Definition
cobalamin biosynthesis protein CobD
Orthology
K02227  
adenosylcobinamide-phosphate synthase [EC:6.3.1.10]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bug00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(846932..847867)
Genome map
AA seq 311 aa AA seqDB search
MLSLPLIVTLATAGVAVDRWIGEPRGAHPLVGFGKWAARLEAHYNRGRRLRLKGLLAWAL
AVLPPVLAASWLVAVLPFFAACAVHVALLWFALGARSLHDHIEPIAQALAQRDLAQARLL
TSRIVSRETAHADEAALSRAAVESALENGNDAIFGALFWFAIAGGPGALGFRLANTLDAM
WGYRTPRYLRFGWAAARLDDVLNWIPARLTAASYALLGDTRTAWRCWREQAPRWDSPNAG
PVMASGAGSLNVLIGGPAVYHGALEHRPTLGFGHPAKAAHITAALMLVERTVILWLAVLI
VLALLSVPLHV
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcgcttccactcatcgtgacgttggcaacggcgggcgtggccgtcgaccgttgg
atcggcgagccgcgcggcgcgcatccgctcgtcggcttcggcaaatgggcggcgcgcctc
gaagcacactacaaccgcggccggcgcctgcggctgaagggcttgctggcctgggcgcta
gccgtgctgccgccggtgctcgctgcctcgtggctcgtggccgtgctgccgttttttgcg
gcctgcgccgtccacgtcgcgctgctgtggttcgcgctcggcgcacgcagtctgcacgac
catatcgagccgattgcgcaggcgctcgcgcagcgcgacctcgcgcaggcgcgcctcttg
acctcacgcatcgtctcgcgcgaaaccgcgcatgccgacgaagccgccctgtcgcgcgcc
gcggtcgaatcggcgctggaaaacggcaacgacgccattttcggcgccctcttctggttt
gcaattgcgggcgggccgggtgcgctcggctttcgcctcgccaatacgctcgatgcgatg
tggggttatcgcacgccgcgctatctacgcttcggctgggccgccgcgcgcctcgacgac
gtgctcaactggattcccgcgcgcctcaccgccgcgagctacgcgctgctcggcgacacg
cgcaccgcgtggcgctgctggcgcgagcaggcgccgcggtgggacagtccgaatgccggg
ccggtgatggcctcgggcgcgggcagcctgaatgtgctgatcggcggcccggcggtgtat
cacggcgcgctcgaacatcggcccacgctcggcttcggccatcccgcaaaggccgcgcat
atcacggccgcgctgatgctggtcgagcgcaccgtcattctgtggcttgcggtactgatc
gtgctggccttgctgagcgtgccgctgcatgtctga

DBGET integrated database retrieval system