KEGG   Burkholderia sp. CCGE1001: BC1001_0799Help
Entry
BC1001_0799       CDS       T01424                                 

Definition
agmatinase
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BC1001_0799
Enzymes [BR:bug01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     BC1001_0799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:890894..891886
Genome map
AA seq 330 aa AA seqDB search
MNTSSFISPEAGERPQPLSGNAMPRCGGIATMMRLPNVGSAAGFDACFVGVPFDLGTSNR
TGARFGPRQIRSESVLLRPYNMATRAAPFDSLRVADLGDVAINPYNLQDSIARIESAYDE
ILQHDCKPVTLGGDHTIALPILRAIHRKHGKVGLIHVDAHADVNDTMMGEKIAHGTPFRR
AVEEGLLDCERVVQIGLRGTGYAAEDFDWCRDQGFEVVQAEACWNQSLAPLMARVRERMG
DAPVYITFDIDGIDPAFAPGTGTPEIAGLTVPQALEIIRGARGLNIVGCDLVEVAPPYDP
FGTTALLGANLAFELLCVLPGVEYRSAAAR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttcctccttcatttcccccgaagccggtgagcgcccccagccgctgtccggc
aatgcgatgccgcgctgcggcggaatcgcgaccatgatgcgtttgccgaacgtcggctcg
gctgcgggattcgacgcctgtttcgtcggtgtgccgttcgatctcggcacgtcgaaccgc
acgggcgcgcgtttcgggccgcgtcagatccgcagcgaatcggtgctgctgcggccgtac
aacatggcgacgcgtgcggcgccgttcgattcgctgcgcgtggccgatctcggcgacgtc
gcgatcaacccgtacaacctgcaggactcgatcgcgcgaatcgaaagcgcttacgacgaa
attctccagcacgattgcaagccggtcacgctcggcggcgatcacacgatcgcgctgccg
atcctgcgcgcgattcatcgcaagcatggcaaggtggggctgattcacgtggacgcgcat
gccgacgtcaacgacacgatgatgggcgagaagatcgcgcacggcacgccgtttcggcgc
gcggtggaggaaggtttgctcgactgcgagcgcgtcgtgcagatcggtctgcgcggcacg
ggttacgcggcggaggacttcgactggtgccgcgaccagggcttcgaagtcgtgcaggcg
gaggcgtgctggaaccagtcgcttgcgccgctgatggcgcgcgtgcgcgagcgcatgggc
gacgcgccggtgtacatcacgttcgacatcgacggaatcgatccggccttcgcgcccggc
acgggcacgccggaaatcgccggactgacggtgccgcaggcgctcgagatcattcgcggc
gcgcgcggcctgaatatcgtcggttgcgatcttgtggaagtcgcgccgccgtacgatccg
ttcggcacgaccgcgctgctgggcgcgaacctcgcgttcgagttgttgtgcgtgctgccg
ggcgtcgaataccggagcgccgccgcgcgttag

DBGET integrated database retrieval system