KEGG   Burkholderia sp. CCGE1001: BC1001_0822Help
Entry
BC1001_0822       CDS       T01424                                 

Definition
hypothetical protein
Orthology
K13543  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BC1001_0822
Enzymes [BR:bug01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     BC1001_0822
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BC1001_0822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:916949..918970
Genome map
AA seq 673 aa AA seqDB search
MAADIPRNASSSTAGKAAFTVVITRPAGQSSELIARLAAAGVAALDFPLIDIAPVADDAP
LRAALGSLERYSLVVFVSPNAIDHAFARSSAIWPHALPVGVVGPGSVRALARHGVSAPAH
QVISPAAGVDDDNGRFDSEGLFAAIDAALGEANLEGKRVLIVRGDGGREWLADRLREAGA
EVETVAAYRRLVPEPSIAAWARVHQLLAGEPHAWLLTSSEGVRNLHELAQEHLTADEIAQ
LKRATLVAPHPRIAQTARALGFDRITVSGAGDERIAQALLSALPTEVQPVPSNPAYSPAQ
SRMTETNASTNASPQPAATASLPPNPPFTPYEAQKRRSASGPLLWFVVVVLACAAGVGGY
ALNRKLERTEQQIAQRQQANDTQTNELRIKTEQALATVRQSDSQVAQLEGKLADAQAAQQ
ALQQQYADLARNRDDWTLAEVGQMLSAASQQLQLTGNTQLALFALQSADTRLAASDSAQA
VAVRKAIAQDIDKLKAAPSTDLTGLAIKLDNAVDQIDSLPLSGEAQIARATPHATTWADT
AKVSAATGEPRWKVWWREVTSGIGQQLTSLVQVRRIDNADAMMVAPDQGYFVRENVKLRL
LSARLALLSRNETTLKSDLQAAQNALTRYFDASSKKTQNVVDLVKQVEAGSAAVELPNLN
TSLQAVNQYRSRG
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgacattccgcgcaacgcgtcgtcatcaaccgccggtaaggcggcgttcacg
gtcgtcattacgcgaccggccggtcagtcgagcgaactgatcgcgcggttggccgcggcc
ggcgtcgccgcgctggactttccgctgatcgacatcgcccccgttgccgacgacgcgccg
ctgcgcgccgcgctcggttcgctggaacgttactcgctcgtcgtgttcgtctcgccgaat
gcgatcgatcacgcgttcgccagaagcagcgcgatctggccgcatgcgttgccggtcggc
gtggtcgggccgggcagcgtgcgcgcgctcgcgcgtcacggcgtgagtgcgcccgcgcac
caggtgatcagtccggcggcgggcgtggatgacgacaacggccgcttcgattccgaaggc
cttttcgccgccatcgacgcagcgctcggcgaagcgaatctggaaggtaagcgcgtgctc
atcgtgcgcggcgacggcggccgcgagtggctcgcggatcgtctgcgcgaagcgggcgcc
gaagtggagacggtcgcggcataccggcgcctcgtgccggagccgtccatcgcggcgtgg
gcgcgcgtgcatcagctgctcgcgggcgaaccgcacgcgtggctcctgaccagttccgag
ggcgtgcgcaatctgcacgaactcgcgcaagaacatctcaccgccgacgaaatcgcgcag
ttaaagcgcgccacgctcgtcgcgccgcatccccgtatcgcgcagaccgcgcgggcattg
ggttttgataggattacggtgtccggcgcgggcgacgagcgcatcgcccaagccttgctc
tccgcgctgccgaccgaagttcaaccggtaccgtccaatccggcttattcaccggctcaa
tcacgcatgactgaaacgaacgcatccacgaacgcttcaccccagccggccgcgactgca
agcttgccgccgaacccacccttcacgccctacgaagcgcaaaagcgccgcagcgcgagc
ggaccgctgctgtggtttgtcgtcgtggttctggcttgcgccgcgggcgtgggcggctat
gcgcttaatcgcaagctcgagcgcaccgagcagcagatcgcgcaacgccagcaggcgaac
gacacgcagaccaacgaactgcgcatcaagaccgagcaggcgcttgccacggtgcgtcag
tccgactcgcaggtcgcgcaactggaaggcaagctcgccgacgcgcaggccgcgcagcag
gcgctgcaacaacagtacgcggatctcgcgcgcaatcgcgacgactggacgctcgccgaa
gtcggccagatgctgtccgccgcgagccagcaattgcagctgaccggcaacacgcaactc
gcgctcttcgcgctgcaaagcgccgacacgcggcttgcggcgtcggacagcgcgcaggcg
gtggcggtgcgcaaggcgattgcgcaggacatcgacaagctgaaggctgcgccttccacc
gatctcacgggtcttgccatcaagctcgacaacgcggtggatcagatcgacagcctgccg
ctctcgggcgaggcgcagatcgcgcgcgccacgccgcacgcgacgacatgggccgacacg
gcgaaggtctcggcggccaccggcgagccgcgctggaaagtgtggtggcgcgaagtgacg
agcggcatcggtcagcagttgacgagcctcgtgcaggtgcgccgcatcgacaacgcggac
gcgatgatggtcgcgcccgaccagggctatttcgtgcgtgagaatgtgaagctgcgtttg
ctgtcggcgcggctcgcgctgttgtcgcgcaacgagaccacgctcaagtccgacctgcag
gcggcgcagaatgcgttgacgcgttatttcgatgcatcgtcgaagaaaacgcagaacgtg
gtcgatctggtcaagcaggtcgaggccggttccgccgccgtcgaattgcctaatctgaat
acgagcctgcaagccgtcaatcaataccggagccgaggttaa

DBGET integrated database retrieval system