KEGG   Burkholderia sp. CCGE1001: BC1001_0835Help
Entry
BC1001_0835       CDS       T01424                                 

Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00360  Phenylalanine metabolism
bug00362  Benzoate degradation
bug00620  Pyruvate metabolism
bug00621  Dioxin degradation
bug00622  Xylene degradation
bug00650  Butanoate metabolism
bug01100  Metabolic pathways
bug01120  Microbial metabolism in diverse environments
bug01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BC1001_0835
   00650 Butanoate metabolism
    BC1001_0835
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BC1001_0835
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BC1001_0835
   00622 Xylene degradation
    BC1001_0835
   00621 Dioxin degradation
    BC1001_0835
Enzymes [BR:bug01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BC1001_0835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA DapB_N NAD_binding_3 F420_oxidored CoA_binding
Motif
Other DBs
NCBI-ProteinID: ADX54288
JGI: BC1001_0835
UniProt: E8YG87
Position
1:928952..929914
Genome map
AA seq 320 aa AA seqDB search
MNEKVKVAIIGPGNIGTDLMIKVMRNSQHLEMAAMVGVDPKSDGLARARRMGVATTAEGI
DGLLKLDAFKNIDIVFDATSASAHKHHNDVLQKHGVQVIDLTPAAVGPYVIPAINLETEN
ASNMNMVTCGGQATIPIVAAVSRVAKVHYAEIIASISSKSAGPGTRANIDEFTETTRSAI
ETLGGATRGKAIIVLNPAEPPLIMRDTVFVLSDLVDVSAVEDSVAQMIASVQAYVPGYRL
KQKIQFDIVSPEKPLNVPGVGAKHGLKTSVFLEVEGAAHYLPSYAGNLDIMTSAALACGD
MMARRRLAAGIVRGRKETIQ
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaaggtgaaagtcgcgatcatcggtcccggcaacatcggcaccgatctgatg
atcaaggtgatgcgcaacagccagcacctggaaatggctgcgatggtgggtgtcgacccg
aaatcggatggactcgcgcgcgctcgaaggatgggcgtggcgacgacagcggaggggatc
gacgggctcttgaaactcgatgcgttcaagaacatcgatatcgtcttcgatgccacgtcg
gccagtgcgcacaagcatcacaacgatgtgctgcaaaagcacggcgtgcaggttatcgac
ctgacgccggctgcggttggcccctatgtgattccggcgatcaatctcgagaccgaaaat
gcgtccaacatgaacatggtcacgtgcggcggccaggcgacgattccgatcgttgcagcc
gtgtcgcgtgtcgcgaaggtccactacgccgaaatcatcgcctctatctcgagcaaatct
gcggggccgggcacgcgggcaaacatcgacgagtttactgagaccacccgcagtgcaatc
gagacgctgggtggagcaactcgcggcaaggcaatcatcgtgctcaacccggcggagccg
ccattgatcatgcgcgataccgtgtttgtattgtctgatctggtagatgttagcgccgtt
gaggatagcgtcgcgcagatgattgccagcgtgcaggcttatgttcccggttatcgcctg
aaacagaagattcagttcgacattgtctcgccggaaaagccgctgaatgtgcctggtgtc
ggcgcaaagcacgggctgaagacgtcggtattccttgaagtagaaggtgccgcccattac
ctgccctcgtacgcgggcaatctcgacatcatgacctcggccgcgctcgcatgcggcgac
atgatggcacgccgacgcctagctgccggcatcgtccgaggccggaaggagactattcaa
tga

DBGET integrated database retrieval system