KEGG   Burkholderia sp. CCGE1001: BC1001_0835Help
Entry
BC1001_0835       CDS       T01424                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BC1001_0835
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BC1001_0835
   00650 Butanoate metabolism
    BC1001_0835
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BC1001_0835
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BC1001_0835
   00622 Xylene degradation
    BC1001_0835
   00621 Dioxin degradation
    BC1001_0835
Enzymes [BR:bug01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BC1001_0835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:928952..929914
Genome map
AA seq 320 aa AA seqDB search
MNEKVKVAIIGPGNIGTDLMIKVMRNSQHLEMAAMVGVDPKSDGLARARRMGVATTAEGI
DGLLKLDAFKNIDIVFDATSASAHKHHNDVLQKHGVQVIDLTPAAVGPYVIPAINLETEN
ASNMNMVTCGGQATIPIVAAVSRVAKVHYAEIIASISSKSAGPGTRANIDEFTETTRSAI
ETLGGATRGKAIIVLNPAEPPLIMRDTVFVLSDLVDVSAVEDSVAQMIASVQAYVPGYRL
KQKIQFDIVSPEKPLNVPGVGAKHGLKTSVFLEVEGAAHYLPSYAGNLDIMTSAALACGD
MMARRRLAAGIVRGRKETIQ
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaaggtgaaagtcgcgatcatcggtcccggcaacatcggcaccgatctgatg
atcaaggtgatgcgcaacagccagcacctggaaatggctgcgatggtgggtgtcgacccg
aaatcggatggactcgcgcgcgctcgaaggatgggcgtggcgacgacagcggaggggatc
gacgggctcttgaaactcgatgcgttcaagaacatcgatatcgtcttcgatgccacgtcg
gccagtgcgcacaagcatcacaacgatgtgctgcaaaagcacggcgtgcaggttatcgac
ctgacgccggctgcggttggcccctatgtgattccggcgatcaatctcgagaccgaaaat
gcgtccaacatgaacatggtcacgtgcggcggccaggcgacgattccgatcgttgcagcc
gtgtcgcgtgtcgcgaaggtccactacgccgaaatcatcgcctctatctcgagcaaatct
gcggggccgggcacgcgggcaaacatcgacgagtttactgagaccacccgcagtgcaatc
gagacgctgggtggagcaactcgcggcaaggcaatcatcgtgctcaacccggcggagccg
ccattgatcatgcgcgataccgtgtttgtattgtctgatctggtagatgttagcgccgtt
gaggatagcgtcgcgcagatgattgccagcgtgcaggcttatgttcccggttatcgcctg
aaacagaagattcagttcgacattgtctcgccggaaaagccgctgaatgtgcctggtgtc
ggcgcaaagcacgggctgaagacgtcggtattccttgaagtagaaggtgccgcccattac
ctgccctcgtacgcgggcaatctcgacatcatgacctcggccgcgctcgcatgcggcgac
atgatggcacgccgacgcctagctgccggcatcgtccgaggccggaaggagactattcaa
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system