KEGG   Burkholderia sp. CCGE1001: BC1001_0985Help
Entry
BC1001_0985       CDS       T01424                                 

Definition
signal transduction histidine kinase with CheB and CheR activity
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bug00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BC1001_0985
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BC1001_0985
Enzymes [BR:bug01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     BC1001_0985
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BC1001_0985
Two-component system [BR:bug02022]
 CheA family
  CheA-CheYBV
   BC1001_0985
Bacterial motility proteins [BR:bug02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BC1001_0985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1101725..1105936
Genome map
AA seq 1403 aa AA seqDB search
MSRQKSTASEVAGPPPTVKSDLRFPVVGIGASAGGVTALQTLFENAPTGMDMAFVVVVHL
PSEHASHFDAILQRATGMSVRQVTATMPLEKNHIYVIAPGKRLEMSDGCLRTPDQEQSPG
PAFTIDHFFRTLADAHDRHAIGIVMSGAGSDGAAGLSRIKEAGGITLAQTPSDAEYAEMP
QHAIATGQVDIVLPAAEMPQRLLELWSNAQRIQLQDLEVAEASNDTGKALVNDPERALSD
ILMHLRVRTGHDFRLYKRATVLRRIERRMQVNGQRDLMGYRDFLRATPDEAHELLGDMLI
GVTQFFRDPDAFEYLGREVIASLFADQPPDGQVRVWVAGCATGEEAYSVSLQLAQAREKA
SSGRSIQVFATDIDEAAIARARTGSYPLAIASDVPAPLLQRYFVREGAHYVVAKSVRERI
LFAPHSLLRDPPFSHLDLISCRNVLIYLERAVQRQILELFHFALRPNGYLFLGTAESADA
ADDLFVVVDKKWRIYRARAVTHRAKPAMGFPPLVQSDVGGSDERSVPLPLSRQPASPAQR
NFSYAELHQRALETYSPPSVIIDRESNVVHLSDNAGRFLRHVGGELSSNIMTLVLPDLRL
DLRTAIFRALQTRTSVEARRVKWAHEGHVSWINMTVRPFHDAVANAEFLLIVFDEVAGHM
TDEEQAEATGQDPVLAQLEQELQHSREQLATIIEQYETSVEELKASNEELQAINEELRST
SEELESSKEELQSVNEELTTANAEMQARIEDTAKANDDLHNIIASSEIATVFVDKEIRVK
RFTPNATAIFNLIDSDLGRSLFHITHTLRYPTLADDVRQSFQSLRLTEREIQSEAGRWYL
MRLLPYRTADDHIDGAVITLIDITDRHEAEEAARAGERRLRLVAQSTKDYAIVIQDSAGT
IVSWNAGAERIFGYSEAEVVGQNIELIYEHNDRQALLPARERDTAAKEGRADDERWHRTK
EGRRIFCSGVVTPIVDTSFNGFAKILRDLTARKQREDASREALAREQAAREQALSANQLK
DEFIAVLSHELKHPLNLIGVKAEMLPRLPEVRHLPAVWDAAASIRHAVRSQAQIIDDLLD
LSRIQTGKLALEVSRVDLVAMIADIADTCEEDAHARGIGLQIDVADEPAITLADPVRCEQ
ILWNLLSNALKFTDAGGHIEVRLSRDGRMLRLEVIDSGQGIEPATLPYIFDMFRQTARGR
RRGGLGIGLALVRQLVEMHGGHVKAESEGPGHGTKMTVWLPAMEDEHGQLRDAVGKHRTI
AGLHILLVEDDAETAASLTTLLELEGANVRAASDGLEALRMLAEEPVDAVVSDIGMPRMD
GYELIRKIRSNPASRAVHAIALTGHNRHDEIQAAHAAGFSSHLAKPLDFQQLLDALGALT
AGGRAAGENGRTRLTPGTAGPGK
NT seq 4212 nt NT seq  +upstreamnt  +downstreamnt
atgtcacggcagaagtcgaccgcctcggaggtcgccggtccgcctcccacggtaaaaagc
gacctgcgttttccagtcgtggggatcggtgcgtcggccggtggcgtaaccgcgctgcag
acgttattcgagaatgcgccgacgggcatggacatggcgtttgtcgtcgtcgtgcatctg
ccgtcggaacacgccagtcacttcgacgcgatcctgcaacgcgcgacaggcatgtcggtg
cgccaggtgacggccaccatgcctctcgagaagaaccatatttacgtgatcgctccgggc
aagcggctggaaatgtccgacggctgcctgaggacgcccgaccaggaacaatctcccggg
ccggctttcacgatcgatcattttttccgcaccctcgcggacgcgcatgaccggcacgca
ataggcatcgtcatgtccggcgcggggtccgatggcgccgcgggactgagccggatcaag
gaagccggcggcattacgcttgctcaaacgccgagcgacgccgagtacgccgagatgccc
cagcatgcaatcgccaccggccaggtcgacatcgtgctgccggccgccgaaatgccgcag
cggctgctggagctgtggagcaacgcgcagcgcatccagcttcaggacctcgaagtggcg
gaagcgtcgaacgacaccggcaaggcgctcgtcaacgatccggaacgagcgctctccgac
atcctcatgcacctgcgcgtgcggactggacacgatttccggctatacaagcgagctacc
gtgcttcggcgcattgagcggcgcatgcaggtgaacggccagcgcgatctgatgggctac
cgcgacttcctgcgcgcaacgcccgacgaggcgcatgaactgctcggcgacatgctgatc
ggcgtcacgcagttttttagggacccggacgcgttcgaatatctcggccgcgaagtgatt
gcctcactatttgccgaccagccaccggatggccaggtgcgggtgtgggtcgcgggctgc
gcgaccggcgaggaggcttactccgtctcgctgcaactcgcgcaggcgcgcgagaaagcc
tcatcgggccgctccatccaggtcttcgccaccgatatcgacgaagcggcgattgcccgt
gcgcgtaccggttcctatccgctcgccattgcgagcgatgtgcccgcgcctttgctccag
cgctatttcgtgcgggaaggcgcgcattacgtggtcgcaaagagcgtacgggaacgcatc
ctgtttgcgccgcatagcctgctgcgcgatccaccgttttcgcatctggatctgatttcg
tgccgcaacgtcctcatctatctcgaacgcgcggtgcagcggcagattctcgaactgttt
cacttcgcgctgcgcccgaacggctatctgttcctcggcacggcggagtccgctgacgcg
gcggacgatctttttgtcgttgtcgacaaaaaatggcgcatctatcgtgcgcgcgccgtc
acgcatcgcgccaagccggccatgggctttccgccgctcgttcagtccgacgtcggcggg
agcgacgagcgatctgtgccgctgccgctctcgcggcaaccggcaagtccggcgcaacgc
aatttctcgtacgcggagcttcatcagcgcgcgctcgaaacatattcgcctccgagcgtg
atcattgaccgcgagtccaatgtcgtgcatctgtccgacaacgcgggccgcttcctgcgg
catgtcggcggcgagttgtcgagcaacatcatgacgctggtcttgcccgaccttaggctc
gacctgcgcacggcgattttccgggcgttgcaaacgcgcaccagcgtcgaagctcgccgc
gtcaaatgggcgcacgaagggcacgtctcgtggatcaacatgacggtgcggccgtttcac
gacgccgtcgctaacgcggagtttctcctgatcgtattcgacgaagtggccggccatatg
accgacgaagaacaggccgaagcgaccggccaggaccctgtcctcgcgcagctcgagcag
gaattgcagcatagccgcgaacaactggccacgatcatcgagcagtacgagacgtcagtg
gaagagctgaaggcgtcgaacgaagaactgcaggcgatcaacgaggaactgcgctccacg
agcgaagagctcgaaagcagcaaggaggagttgcagtcggtcaacgaggaattgaccacc
gccaacgcggagatgcaggcgcgaattgaagacacggctaaagccaacgacgacttgcac
aacatcattgcgtcgagcgagatcgccacggtgttcgtggacaaggaaatcagggtcaaa
cgctttacgccgaacgcgacggccattttcaacctgattgactccgacctcgggcgctcg
ctgttccacatcacgcatacgctgcgctacccgacgctcgccgacgacgtgaggcagtcg
ttccagtctctgcggctgaccgagcgcgagattcagagcgaggccggccgctggtatctt
atgcgcctcctgccttatcgcaccgcagacgaccatatcgatggcgcggtgatcacgctc
atcgacatcaccgaccgtcacgaagccgaagaagccgcgcgggcaggcgagcgccgtttg
cgactcgtcgcgcaatcgacgaaagactacgcgatcgtcattcaggattccgcgggaacc
atcgtgagttggaacgcgggcgcagaacgcatttttggctactcggaagcggaagtggtc
ggccagaacatcgagctgatctacgagcacaacgaccgccaggcgctcctgcccgcgcgc
gagcgcgacaccgcagcgaaggaaggccgcgccgacgacgagcgctggcatcgcaccaag
gaaggccgccgcatcttctgcagcggcgtcgtgacgccgattgtcgacacgtcgttcaac
ggctttgcgaagattctgcgcgacctgaccgcgcgcaaacagcgcgaggatgcgagccgc
gaagcgctcgcccgcgagcaggcggcgcgcgagcaggcgcttagcgccaaccagttgaaa
gacgagttcattgccgtgctgtcgcacgagctgaagcatccgctcaacctgatcggcgtg
aaggccgagatgctgccacgcttgccggaagtgcgtcacctgcccgccgtttgggatgcg
gccgcgtccatccggcatgcggtacgcagccaggcgcagatcatcgacgatttgctcgat
ctttcgcgaatccagaccggcaagctcgcgctcgaagtctcgcgtgtcgacctcgtggcg
atgattgcggatatcgccgacacctgcgaggaggacgcacacgcccgcggcatcggcttg
cagatcgacgtggcagatgagcctgccatcacgctcgccgatccggtccgctgcgagcag
attctctggaacctgttgtccaacgcactgaaattcacggatgccggtggacacatcgag
gtgcgtctgtcgcgcgatggccgcatgctgcgtctggaagttatcgacagcgggcagggc
atcgagccggccacgctgccttatatcttcgatatgttccgtcagacggcgcgcggccgc
aggcgtggcggtctcggcatcggcctcgcgctcgtgaggcagctcgtcgagatgcacggc
ggccacgtcaaagcggagtcggaaggtccgggccacggcaccaaaatgacagtatggctt
ccggccatggaagacgagcacgggcagttgcgcgacgccgttgggaaacaccggaccatc
gccggtctgcacatccttctggtcgaggacgatgcggaaacggccgcgtcgctcaccacg
ctgctcgaactcgaaggcgccaacgtcagggcggccagcgacggtctggaggctctacgc
atgctcgccgaggaaccagtggacgcggtggtctccgacatcggcatgccgcgcatggac
ggttacgaactgatccgcaagatcaggtccaatcccgcgtcgagagcagttcatgcgatt
gcgctgaccggccacaaccgacacgacgagattcaggccgcgcatgctgccggcttcagc
tcgcacctggccaagccgctcgacttccagcaactgctggatgcactcggcgccctgacg
gcgggcgggcgagccgccggcgaaaacgggcgcacccgactcacgccgggcacggccggc
cccggaaagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system