KEGG   Burkholderia sp. CCGE1001: BC1001_0985Help
Entry
BC1001_0985       CDS       T01424                                 

Definition
signal transduction histidine kinase with CheB and CheR activity
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bug02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bug02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1101725..1105936
Genome map
AA seq 1403 aa AA seqDB search
MSRQKSTASEVAGPPPTVKSDLRFPVVGIGASAGGVTALQTLFENAPTGMDMAFVVVVHL
PSEHASHFDAILQRATGMSVRQVTATMPLEKNHIYVIAPGKRLEMSDGCLRTPDQEQSPG
PAFTIDHFFRTLADAHDRHAIGIVMSGAGSDGAAGLSRIKEAGGITLAQTPSDAEYAEMP
QHAIATGQVDIVLPAAEMPQRLLELWSNAQRIQLQDLEVAEASNDTGKALVNDPERALSD
ILMHLRVRTGHDFRLYKRATVLRRIERRMQVNGQRDLMGYRDFLRATPDEAHELLGDMLI
GVTQFFRDPDAFEYLGREVIASLFADQPPDGQVRVWVAGCATGEEAYSVSLQLAQAREKA
SSGRSIQVFATDIDEAAIARARTGSYPLAIASDVPAPLLQRYFVREGAHYVVAKSVRERI
LFAPHSLLRDPPFSHLDLISCRNVLIYLERAVQRQILELFHFALRPNGYLFLGTAESADA
ADDLFVVVDKKWRIYRARAVTHRAKPAMGFPPLVQSDVGGSDERSVPLPLSRQPASPAQR
NFSYAELHQRALETYSPPSVIIDRESNVVHLSDNAGRFLRHVGGELSSNIMTLVLPDLRL
DLRTAIFRALQTRTSVEARRVKWAHEGHVSWINMTVRPFHDAVANAEFLLIVFDEVAGHM
TDEEQAEATGQDPVLAQLEQELQHSREQLATIIEQYETSVEELKASNEELQAINEELRST
SEELESSKEELQSVNEELTTANAEMQARIEDTAKANDDLHNIIASSEIATVFVDKEIRVK
RFTPNATAIFNLIDSDLGRSLFHITHTLRYPTLADDVRQSFQSLRLTEREIQSEAGRWYL
MRLLPYRTADDHIDGAVITLIDITDRHEAEEAARAGERRLRLVAQSTKDYAIVIQDSAGT
IVSWNAGAERIFGYSEAEVVGQNIELIYEHNDRQALLPARERDTAAKEGRADDERWHRTK
EGRRIFCSGVVTPIVDTSFNGFAKILRDLTARKQREDASREALAREQAAREQALSANQLK
DEFIAVLSHELKHPLNLIGVKAEMLPRLPEVRHLPAVWDAAASIRHAVRSQAQIIDDLLD
LSRIQTGKLALEVSRVDLVAMIADIADTCEEDAHARGIGLQIDVADEPAITLADPVRCEQ
ILWNLLSNALKFTDAGGHIEVRLSRDGRMLRLEVIDSGQGIEPATLPYIFDMFRQTARGR
RRGGLGIGLALVRQLVEMHGGHVKAESEGPGHGTKMTVWLPAMEDEHGQLRDAVGKHRTI
AGLHILLVEDDAETAASLTTLLELEGANVRAASDGLEALRMLAEEPVDAVVSDIGMPRMD
GYELIRKIRSNPASRAVHAIALTGHNRHDEIQAAHAAGFSSHLAKPLDFQQLLDALGALT
AGGRAAGENGRTRLTPGTAGPGK
NT seq 4212 nt NT seq  +upstreamnt  +downstreamnt
atgtcacggcagaagtcgaccgcctcggaggtcgccggtccgcctcccacggtaaaaagc
gacctgcgttttccagtcgtggggatcggtgcgtcggccggtggcgtaaccgcgctgcag
acgttattcgagaatgcgccgacgggcatggacatggcgtttgtcgtcgtcgtgcatctg
ccgtcggaacacgccagtcacttcgacgcgatcctgcaacgcgcgacaggcatgtcggtg
cgccaggtgacggccaccatgcctctcgagaagaaccatatttacgtgatcgctccgggc
aagcggctggaaatgtccgacggctgcctgaggacgcccgaccaggaacaatctcccggg
ccggctttcacgatcgatcattttttccgcaccctcgcggacgcgcatgaccggcacgca
ataggcatcgtcatgtccggcgcggggtccgatggcgccgcgggactgagccggatcaag
gaagccggcggcattacgcttgctcaaacgccgagcgacgccgagtacgccgagatgccc
cagcatgcaatcgccaccggccaggtcgacatcgtgctgccggccgccgaaatgccgcag
cggctgctggagctgtggagcaacgcgcagcgcatccagcttcaggacctcgaagtggcg
gaagcgtcgaacgacaccggcaaggcgctcgtcaacgatccggaacgagcgctctccgac
atcctcatgcacctgcgcgtgcggactggacacgatttccggctatacaagcgagctacc
gtgcttcggcgcattgagcggcgcatgcaggtgaacggccagcgcgatctgatgggctac
cgcgacttcctgcgcgcaacgcccgacgaggcgcatgaactgctcggcgacatgctgatc
ggcgtcacgcagttttttagggacccggacgcgttcgaatatctcggccgcgaagtgatt
gcctcactatttgccgaccagccaccggatggccaggtgcgggtgtgggtcgcgggctgc
gcgaccggcgaggaggcttactccgtctcgctgcaactcgcgcaggcgcgcgagaaagcc
tcatcgggccgctccatccaggtcttcgccaccgatatcgacgaagcggcgattgcccgt
gcgcgtaccggttcctatccgctcgccattgcgagcgatgtgcccgcgcctttgctccag
cgctatttcgtgcgggaaggcgcgcattacgtggtcgcaaagagcgtacgggaacgcatc
ctgtttgcgccgcatagcctgctgcgcgatccaccgttttcgcatctggatctgatttcg
tgccgcaacgtcctcatctatctcgaacgcgcggtgcagcggcagattctcgaactgttt
cacttcgcgctgcgcccgaacggctatctgttcctcggcacggcggagtccgctgacgcg
gcggacgatctttttgtcgttgtcgacaaaaaatggcgcatctatcgtgcgcgcgccgtc
acgcatcgcgccaagccggccatgggctttccgccgctcgttcagtccgacgtcggcggg
agcgacgagcgatctgtgccgctgccgctctcgcggcaaccggcaagtccggcgcaacgc
aatttctcgtacgcggagcttcatcagcgcgcgctcgaaacatattcgcctccgagcgtg
atcattgaccgcgagtccaatgtcgtgcatctgtccgacaacgcgggccgcttcctgcgg
catgtcggcggcgagttgtcgagcaacatcatgacgctggtcttgcccgaccttaggctc
gacctgcgcacggcgattttccgggcgttgcaaacgcgcaccagcgtcgaagctcgccgc
gtcaaatgggcgcacgaagggcacgtctcgtggatcaacatgacggtgcggccgtttcac
gacgccgtcgctaacgcggagtttctcctgatcgtattcgacgaagtggccggccatatg
accgacgaagaacaggccgaagcgaccggccaggaccctgtcctcgcgcagctcgagcag
gaattgcagcatagccgcgaacaactggccacgatcatcgagcagtacgagacgtcagtg
gaagagctgaaggcgtcgaacgaagaactgcaggcgatcaacgaggaactgcgctccacg
agcgaagagctcgaaagcagcaaggaggagttgcagtcggtcaacgaggaattgaccacc
gccaacgcggagatgcaggcgcgaattgaagacacggctaaagccaacgacgacttgcac
aacatcattgcgtcgagcgagatcgccacggtgttcgtggacaaggaaatcagggtcaaa
cgctttacgccgaacgcgacggccattttcaacctgattgactccgacctcgggcgctcg
ctgttccacatcacgcatacgctgcgctacccgacgctcgccgacgacgtgaggcagtcg
ttccagtctctgcggctgaccgagcgcgagattcagagcgaggccggccgctggtatctt
atgcgcctcctgccttatcgcaccgcagacgaccatatcgatggcgcggtgatcacgctc
atcgacatcaccgaccgtcacgaagccgaagaagccgcgcgggcaggcgagcgccgtttg
cgactcgtcgcgcaatcgacgaaagactacgcgatcgtcattcaggattccgcgggaacc
atcgtgagttggaacgcgggcgcagaacgcatttttggctactcggaagcggaagtggtc
ggccagaacatcgagctgatctacgagcacaacgaccgccaggcgctcctgcccgcgcgc
gagcgcgacaccgcagcgaaggaaggccgcgccgacgacgagcgctggcatcgcaccaag
gaaggccgccgcatcttctgcagcggcgtcgtgacgccgattgtcgacacgtcgttcaac
ggctttgcgaagattctgcgcgacctgaccgcgcgcaaacagcgcgaggatgcgagccgc
gaagcgctcgcccgcgagcaggcggcgcgcgagcaggcgcttagcgccaaccagttgaaa
gacgagttcattgccgtgctgtcgcacgagctgaagcatccgctcaacctgatcggcgtg
aaggccgagatgctgccacgcttgccggaagtgcgtcacctgcccgccgtttgggatgcg
gccgcgtccatccggcatgcggtacgcagccaggcgcagatcatcgacgatttgctcgat
ctttcgcgaatccagaccggcaagctcgcgctcgaagtctcgcgtgtcgacctcgtggcg
atgattgcggatatcgccgacacctgcgaggaggacgcacacgcccgcggcatcggcttg
cagatcgacgtggcagatgagcctgccatcacgctcgccgatccggtccgctgcgagcag
attctctggaacctgttgtccaacgcactgaaattcacggatgccggtggacacatcgag
gtgcgtctgtcgcgcgatggccgcatgctgcgtctggaagttatcgacagcgggcagggc
atcgagccggccacgctgccttatatcttcgatatgttccgtcagacggcgcgcggccgc
aggcgtggcggtctcggcatcggcctcgcgctcgtgaggcagctcgtcgagatgcacggc
ggccacgtcaaagcggagtcggaaggtccgggccacggcaccaaaatgacagtatggctt
ccggccatggaagacgagcacgggcagttgcgcgacgccgttgggaaacaccggaccatc
gccggtctgcacatccttctggtcgaggacgatgcggaaacggccgcgtcgctcaccacg
ctgctcgaactcgaaggcgccaacgtcagggcggccagcgacggtctggaggctctacgc
atgctcgccgaggaaccagtggacgcggtggtctccgacatcggcatgccgcgcatggac
ggttacgaactgatccgcaagatcaggtccaatcccgcgtcgagagcagttcatgcgatt
gcgctgaccggccacaaccgacacgacgagattcaggccgcgcatgctgccggcttcagc
tcgcacctggccaagccgctcgacttccagcaactgctggatgcactcggcgccctgacg
gcgggcgggcgagccgccggcgaaaacgggcgcacccgactcacgccgggcacggccggc
cccggaaagtga

DBGET integrated database retrieval system