KEGG   Burkholderia sp. CCGE1001: BC1001_1365Help
Entry
BC1001_1365       CDS       T01424                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bug00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BC1001_1365
Enzymes [BR:bug01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BC1001_1365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1556952..1559324
Genome map
AA seq 790 aa AA seqDB search
MSTFNQAPAAPLQLEDIGVNLPAPADFSIALAEGFARRIGALARRAGASGEAVKWAARAA
FAASRATAEGHVCVPLGALAHRFDASAAEVRAALFASGMASDGAYTAAALRPLVIDGQGR
LYLARYYDYERRLARALVAHAGASAVQGRPEVAAERLTGRAGNVAGERRERMAGAGGAEG
GVAGQEAARASAERNAEADADANATQTLHQRLLRYFGPLKDDEVDWQRVAAVVALSGRLT
IVSGGPGTGKTTTVVGVLACLLDARADLRIALAAPTGKAAQRMQEALLARAGDLPPELAA
RLPQTSYTLHRLLGSGPGGRFRHHRDNPLPYDVVVIDEASMIDVAMAAHLLDAIAPHTRL
VMLGDKDQLAAVEAGAVFAELSARPAFTMPGVQRIAGALGIDEARFTQALPRVGHAQDAW
AERSRQDDAADPRRSDSPSDDLFAKSDAAQALDAARNADLFDADANANANANVANPPVNA
SAGASPSPSPSPSPSPSPSPSPSPSPAASPPPHQPPSPLADCVVWLERNYRFGLESPIGR
LSLAIRHGAASAALEVLVADATRHAAELHDDAHPTLAERTVERLAAGFAPYANALAAALA
EATPDPTPLFDGLNRFRVLCATRSGPRGVDQVNALMAAQVRRAAGVTLAVGAQWFAGRPV
MVTRNDYALGLFNGDIGIALPGAGGVLRVYFRTGDGSLRAVSPAALPPHDTAFALTVHKS
QGSEFEHAVLVLPSTFSRVLSRELVYTAITRARERVEVIGARAVLAQAIATPTQRDSGLA
ARIAEASRGR
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgttcaatcaggcgccagccgcgccgctgcaactcgaggacatcggggtcaat
ctgcccgcgccggctgatttcagcattgcgctcgcggagggattcgcgcgccgcatcggc
gcattggcacgacgcgcgggggcgtcgggcgaggcggtgaaatgggcggcgcgcgcggct
ttcgcggcgagccgcgcgacggcggaagggcacgtgtgtgtgccgctcggggcgctcgca
catcgtttcgacgcgtctgccgccgaggttcgcgcggcgctgttcgcgagcggcatggcg
agcgatggtgcgtacaccgccgcggcgttgcggccgctcgtgatcgacggacaagggcgc
ttgtatctcgcgcgttactacgattacgaacggcgtctcgcgcgggcgctggtcgcgcat
gcgggggcgagcgcggttcaaggccggccggaggtcgcggcggagcggctgaccggacgt
gccggcaacgtcgcgggtgagcggcgggagcggatggcgggcgcgggaggcgcggagggc
ggcgttgccggccaggaggcggcgcgcgcgagcgccgaacgcaacgccgaagccgacgcc
gacgccaatgccacacaaacgctgcaccagcggctgctacgctacttcggcccactgaag
gacgacgaggtggactggcagcgcgtggccgcggtcgtggcgctgtcgggccggctcacg
atcgtgagcggcggtccgggcaccggtaagacgacgaccgtcgtcggtgtgctcgcgtgc
ctgctggatgcgcgcgccgatctgcgaatcgcgctcgccgcgcccaccggcaaggcggcg
cagcgcatgcaggaagccttgctcgcgcgcgccggcgatctgccgccggagctcgccgcg
cgtttgccgcagacttcctacacgttgcatcgtctgctcgggtctgggccgggcgggcgc
ttccggcatcatcgggataacccgttgccttacgacgtcgtggtgatcgacgaggcgtcg
atgattgacgtcgcgatggccgcgcacctgctcgatgccattgcgccgcacacgcggctc
gtgatgctcggtgacaaggaccagcttgcagccgtggaggccggtgccgtgttcgcggaa
ctgagcgcgcggcctgcgttcacgatgccgggcgtacagcgaattgcaggcgctctgggt
atcgacgaggcgcggttcacgcaggcgctgccacgtgtcgggcacgctcaggacgcatgg
gccgagcgctcccggcaagatgacgccgccgatccgcgccgttccgacagtccgtccgac
gacctgttcgccaaatccgacgcggcccaggcgctcgacgcagcacgcaacgccgacctc
ttcgacgccgacgccaacgccaacgccaacgccaacgtcgccaacccccccgtcaacgcg
agcgcgggcgccagccccagccccagccccagccccagccccagccccagccccagcccc
agccccagccccagccccgccgcgagcccgccgccgcaccagccgccaagcccactcgcg
gattgcgtcgtctggctggagcgcaactatcgattcgggctcgaatctccaattggccgc
ctttcgctggcgattcgccatggcgcggcgagcgccgcactcgaggtgctggtcgccgac
gccactcgacacgccgccgagcttcacgacgacgcgcaccctacgctggccgagcgcacc
gtcgagcgcctcgccgccggcttcgcgccctacgcgaatgcgctggctgccgcgctggcc
gaggcgacgccggatcccacgccgcttttcgacgggctcaatcgtttccgcgtcctgtgc
gcgacccgctccggcccgcgcggcgtcgatcaggtcaacgcgctgatggcggcgcaagtg
cggcgcgcggcgggcgttacgctcgcggtcggcgcgcagtggttcgccgggcggcccgtc
atggttacgcgcaacgactatgcgctgggactcttcaacggcgacatcggcattgcactg
cccggcgcgggcggcgtgctgcgggtctactttcgtaccggcgacggcagtctgcgcgcc
gtgtcgccggccgcgctgccgccgcacgacaccgcgtttgcgctgacggttcacaagtcg
caaggctccgaattcgagcatgcggtgttggtgctgccgtcgacattcagcagagtgttg
tcgcgtgaactcgtgtacacggcgatcacgcgcgctcgtgagcgcgtggaggtgatcggc
gcgcgcgctgtactggctcaggcgattgcgacgcccacacagcgcgactcgggtctcgcc
gcgagaatcgcggaggcatcgcgtggccgttag

DBGET integrated database retrieval system