KEGG   Burkholderia sp. CCGE1001: BC1001_1391Help
Entry
BC1001_1391       CDS       T01424                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00020  Citrate cycle (TCA cycle)
bug00310  Lysine degradation
bug01100  Metabolic pathways
bug01110  Biosynthesis of secondary metabolites
bug01120  Microbial metabolism in diverse environments
bug01130  Biosynthesis of antibiotics
bug01200  Carbon metabolism
Module
bug_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bug_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BC1001_1391
  Amino acid metabolism
   00310 Lysine degradation
    BC1001_1391
Enzymes [BR:bug01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BC1001_1391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ADX54827
JGI: BC1001_1391
UniProt: E8YL01
Position
1:1590661..1591938
Genome map
AA seq 425 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIEIETDKVVLEVPAPSAGVLAQV
IANDGDTVTADQVIAKIDTEGKAGAAAVEAEVKPAPVAAPAPAAAPAAQAASAAGANTAA
SPAAGKLMAEKGLSAGDVAGTGRDGRITKGDVLTAGAPAAKAAAPAPAAAPKAAKPSLPD
VKAPASADQWLKDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMDLRNKY
KDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLV
VPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINP
PQSAILGVHATKERAVVENGQIVIRPMNYLALSYDHRIIDGREAVLSLVAMKDALEDPAR
LLLDL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctattgttgaagtcaaggttccccagctgtccgagtcggtctcggaagccacgatg
ctgcagtggaagaaaaagcccggcgaggctgttgctcaggacgaaattctcatcgaaatc
gagaccgacaaggtcgtgctcgaagtgccggcaccctcggccggcgtgctcgcgcaagtc
atcgcgaacgacggcgacaccgtcacggccgatcaggtgatcgccaagatcgatacggaa
ggcaaggctggcgccgctgccgtcgaagccgaagtgaagccggctccggtcgccgctccg
gcaccggccgctgcaccggctgcgcaagctgcctccgcggcgggtgcgaacaccgctgct
tcgccggctgccggcaagctgatggcggagaagggcctctccgccggcgacgtcgccggc
acgggccgcgacggccgcatcaccaagggcgacgtgctgacggcaggtgcaccggctgcc
aaggctgctgcgccggcaccggccgctgcaccgaaggctgcgaagccgtcgctgccggac
gtgaaggcgcccgcatcggccgatcaatggctgaaagaccgcccggaacaacgcgtgccg
atgtcgcgtctgcgcgcgcgtatcgccgagcgtctgctcgaatcgcagcaaaccaacgcg
atcctgaccacgttcaacgaagtgaacatggcgccggtgatggacctgcgcaacaagtac
aaggacaagttcgaaaaggaacacggcgtgaagctcggcttcatgtcgttcttcgtgaag
gcggccgtgcatgcgctgaagaagttcccgctcgtgaacgcgtcgatcgacggtaacgac
atcgtctatcacggctacttcgacatcggtatcgcggtcggttcgccgcgcggtctggtg
gtgccgatcctgcgcaatgcggatcagctgagcctcgccgaaatcgagaagaagatcgcc
gaattcggtcagaaggcgaaggacggcaagctgtccatcgaagaaatgacgggcggtacg
ttctccatctcgaacggcggcgtgttcggctcgatgctgtcgacgccgatcatcaacccg
ccgcagtccgcgattctcggcgtgcacgccacgaaggaacgcgcggtcgtggaaaacggc
cagatcgtgatccgcccgatgaactatctggcgctgtcgtacgaccaccgcatcatcgac
ggccgcgaagccgtgctgtcgctcgtcgcgatgaaggatgcgctggaagacccggcgcgc
ctgctgctcgacctgtaa

DBGET integrated database retrieval system