KEGG   Burkholderia sp. CCGE1001: BC1001_1579Help
Entry
BC1001_1579       CDS       T01424                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BC1001_1579
Enzymes [BR:bug01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BC1001_1579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1808044..1809012
Genome map
AA seq 322 aa AA seqDB search
MSAQQQGGRVVILGIYVTDLTFRAARMPLIGETIAGSAFAMGPGGKGSNQAVAAARAGAE
VVFCTRIGDDAFGSIAQATWAREGITARATVVAGVATGAAHIFVDDTTGMNAIIVAAGAA
GTLCAADVDAIEADIAGARVFVTQLEQPLAAARRGLEVARRHGVVTVFNPAPAMPLDDDI
FPLCDYITPNESEAAALTGVQISTVDDARRAADVLLAKGVGAVIVTLGEGGALLHDATQS
VWLPAFRCGNVVETAGAGDGFTGGFAAALARGEDAVSALRFGCALAGISVTRAGTAPSMP
TLAEVNEVLNRHSESSRAAQVS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcagcagcagggcggacgcgtcgtcattctcggcatctacgtgaccgatctg
acgtttcgcgcggcgcgcatgccgctgatcggcgagacgattgcgggctccgcgtttgcg
atggggccgggcggcaagggctcgaatcaggccgtggccgccgcccgcgcgggcgccgag
gtggtgttctgcacgcgcatcggcgacgatgcattcggctcgatcgcgcaggccacctgg
gcgcgcgagggcatcacggcgcgtgccacggtggtggccggcgtcgcgacgggcgctgca
catatcttcgtcgacgacaccaccggcatgaacgcgatcatcgtcgcggcaggcgcggca
gggacactgtgcgccgccgacgtcgatgcgatagaagccgacattgcgggcgcgcgggtc
ttcgtgacgcagctcgaacagccgctcgcggccgcgcggcgcggactcgaagtggcgcgc
aggcatggcgtcgtcaccgtgttcaatccggcgcccgccatgccgctcgacgacgacatc
ttcccgctgtgcgactacatcacgccgaacgaaagcgaggcggcggcgctcaccggcgtg
cagatatcgactgttgacgacgcccggcgcgcggccgacgtcctgttggccaaaggtgtg
ggcgccgtcatcgtcacgctgggcgaaggcggcgcgttgctgcatgacgcgacgcaatcg
gtctggctgcccgcgtttcgctgcggtaacgtcgtggaaacggcgggcgcgggcgacggc
ttcaccggcggcttcgcggccgcgctggcacgcggcgaggacgcggtatcggcgctgcgc
ttcggttgcgcgctcgcgggcatctcggtcacgcgcgcgggcaccgcgccttccatgccg
acgctcgccgaagtcaatgaggtgctgaatcggcacagcgaatcgagccgggcagcacag
gtgtcgtaa

DBGET integrated database retrieval system