KEGG   Burkholderia sp. CCGE1001: BC1001_1640Help
Entry
BC1001_1640       CDS       T01424                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bug01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bug00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bug00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1878539..1880710
Genome map
AA seq 723 aa AA seqDB search
MTQMNPRGGLQVAANLDQFVETEALPGTGIDSAAFWSGFDALVHELAPKNRALLAERDRL
QTELDAWHRANPGPVRDLRAYRAFLEGIGYIVPAPASVKATTANVDTEIAEQAGPQLVVP
LSNQRYALNAANARWGSLYDALYGTDAIPDTEGAERQKTFNPVRGAAVIAYARKFLDEAA
PLASGSHADATRYSVQEGKLVVALKNGASELETTAQFIGYQGDASAPSAVLLKHNGLHVE
IQIDANDPIGKTDAAQVKDVVVEAAVSTIIDCEDSVAAVDADDKVQLYRNWLGLMNGDLT
EEVTKNGKTFTRRLNADREYIGADGKTPVTLHGRSLLFIRNVGHLMTNPAVLTKDGAEIP
EGILDAVITTLCALHDRKNKLNSRTGSIYIVKPKMHGPAEVAFASELFARVEDLLKLPRN
TIKMGIMDEERRTSVNLLACIAEAAERVAFINTGFLDRTGDEMHSAMEAGPMMRKGDMKS
STWIAAYERSNVLVGLHAGLRGRSQIGKGMWAMPDLMHAMLEQKIGHPKAGANTAWVPSP
TAATLHALHYHQVDVQAVQQELERTEYAKVRDELLDGLLTIPVVETAKWSADEIRAELDN
NAQGILGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLYHGVVTREQVEE
TFRRMAKVVDQQNAADPFYKPMAPGFDTIAFKAAQALVFEGRQQPSGYTEPLLHKFRLAV
KKG
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgactcagatgaacccgcgcggcggactgcaggtcgccgccaatctcgaccagttcgtt
gaaacggaagccctgcccggcaccggaatcgacagcgccgcattctggtcgggtttcgac
gccctcgtgcatgagctggcgcccaaaaaccgtgcgctgctcgccgagcgcgaccgcctg
caaacggagctggacgcctggcatcgcgccaatccggggccggtgcgcgacctgcgcgcc
tatcgtgcgtttcttgagggcatcggctatatcgtgcccgcgcccgccagcgtgaaggcg
accaccgcgaacgtcgacacggaaatcgccgaacaggccggcccgcagttggtggtgccg
ctgtcgaatcagcgctatgcgctcaatgcggcgaacgcgcggtggggcagcctctacgac
gcgctgtacggcaccgacgcgattcccgacaccgagggcgccgaacggcagaagaccttc
aacccggtgcgcggcgccgccgttatcgcctatgcccgcaagttcctcgatgaggccgcg
ccgctcgcgagcggctcgcatgcggatgcgacgcgttacagcgtgcaggagggcaagctc
gtcgtcgcgttgaaaaacggcgcgagcgaactggagacgaccgcgcagttcatcggctat
cagggcgatgcgagcgcgccctcggcagtgctgctgaagcacaacggcctgcacgtcgag
atccagatcgatgcgaacgacccgatcggcaagaccgacgccgcgcaggtaaaggacgtg
gtggtggaggcggcggtgagcaccatcatcgactgtgaagactccgtggcggccgtggat
gcagacgacaaggtccagctctatcgcaactggctcgggctgatgaacggcgatctgacg
gaagaggtcacgaaaaacggcaagaccttcacgcgccgtctgaacgcggatcgcgaatac
atcggcgcagacggcaagacgccggtcacgctgcatgggcgctcgctcctcttcatccgc
aacgtcggccacctgatgaccaatccggccgtgctgacgaaagacggcgcggagattccc
gaagggattctcgatgcagtgatcaccacgctgtgcgcgctgcacgatcgcaagaacaag
ctcaattcgcgcaccggctccatctatatcgtgaagccgaaaatgcacggcccggccgaa
gtggcgttcgcgagcgagctgtttgcgcgcgtcgaagacctgctcaagctgccgcgcaac
acgatcaagatgggcatcatggacgaggagcgccgcacgagcgtgaacctgctcgcgtgt
atcgcggaggccgcggagcgcgtcgcgttcatcaacacgggctttctcgatcgcaccggc
gacgagatgcatagcgcgatggaagctggcccgatgatgcgcaagggcgacatgaagtcg
agcacgtggattgcggcctatgagcgcagcaatgtgctcgtcggcttgcacgccgggctg
cgcggccgctcgcagatcggcaagggcatgtgggccatgcccgatctgatgcacgccatg
ctcgaacagaagatcggccatccgaaggccggcgcgaacaccgcgtgggtgccctcgccc
accgccgcgacgctgcatgcgctgcactatcaccaggtcgacgtgcaggcggttcagcag
gaactggagcgcacggagtacgcgaaggtgcgcgacgagctgctggacggtctgctgacc
attcccgtcgtcgaaaccgcgaagtggagcgccgacgaaattcgcgccgagctcgacaac
aacgcgcaaggcattctcggctacgtggtgcgctggatcgaccagggcgtgggctgctcg
aaggtgccggatattcacgacgtcggcctgatggaagaccgcgcgacgctgcgtatctcg
agccagcacatcgccaactggctgtatcacggcgtggtgacgcgcgagcaggtcgaagag
accttcaggcgcatggcgaaagtggtcgatcagcagaatgccgccgatcccttctacaag
ccgatggcgccgggtttcgacaccatcgcgttcaaggccgcgcaggcgctggtgttcgaa
ggacgccagcagccgagcggctacacggaaccgttgctgcacaagttccgtctcgcggtg
aagaaaggctga

DBGET integrated database retrieval system