KEGG   Burkholderia sp. CCGE1001: BC1001_1640Help
Entry
BC1001_1640       CDS       T01424                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1001_1640
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BC1001_1640
   00630 Glyoxylate and dicarboxylate metabolism
    BC1001_1640
Enzymes [BR:bug01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BC1001_1640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1878539..1880710
Genome map
AA seq 723 aa AA seqDB search
MTQMNPRGGLQVAANLDQFVETEALPGTGIDSAAFWSGFDALVHELAPKNRALLAERDRL
QTELDAWHRANPGPVRDLRAYRAFLEGIGYIVPAPASVKATTANVDTEIAEQAGPQLVVP
LSNQRYALNAANARWGSLYDALYGTDAIPDTEGAERQKTFNPVRGAAVIAYARKFLDEAA
PLASGSHADATRYSVQEGKLVVALKNGASELETTAQFIGYQGDASAPSAVLLKHNGLHVE
IQIDANDPIGKTDAAQVKDVVVEAAVSTIIDCEDSVAAVDADDKVQLYRNWLGLMNGDLT
EEVTKNGKTFTRRLNADREYIGADGKTPVTLHGRSLLFIRNVGHLMTNPAVLTKDGAEIP
EGILDAVITTLCALHDRKNKLNSRTGSIYIVKPKMHGPAEVAFASELFARVEDLLKLPRN
TIKMGIMDEERRTSVNLLACIAEAAERVAFINTGFLDRTGDEMHSAMEAGPMMRKGDMKS
STWIAAYERSNVLVGLHAGLRGRSQIGKGMWAMPDLMHAMLEQKIGHPKAGANTAWVPSP
TAATLHALHYHQVDVQAVQQELERTEYAKVRDELLDGLLTIPVVETAKWSADEIRAELDN
NAQGILGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLYHGVVTREQVEE
TFRRMAKVVDQQNAADPFYKPMAPGFDTIAFKAAQALVFEGRQQPSGYTEPLLHKFRLAV
KKG
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgactcagatgaacccgcgcggcggactgcaggtcgccgccaatctcgaccagttcgtt
gaaacggaagccctgcccggcaccggaatcgacagcgccgcattctggtcgggtttcgac
gccctcgtgcatgagctggcgcccaaaaaccgtgcgctgctcgccgagcgcgaccgcctg
caaacggagctggacgcctggcatcgcgccaatccggggccggtgcgcgacctgcgcgcc
tatcgtgcgtttcttgagggcatcggctatatcgtgcccgcgcccgccagcgtgaaggcg
accaccgcgaacgtcgacacggaaatcgccgaacaggccggcccgcagttggtggtgccg
ctgtcgaatcagcgctatgcgctcaatgcggcgaacgcgcggtggggcagcctctacgac
gcgctgtacggcaccgacgcgattcccgacaccgagggcgccgaacggcagaagaccttc
aacccggtgcgcggcgccgccgttatcgcctatgcccgcaagttcctcgatgaggccgcg
ccgctcgcgagcggctcgcatgcggatgcgacgcgttacagcgtgcaggagggcaagctc
gtcgtcgcgttgaaaaacggcgcgagcgaactggagacgaccgcgcagttcatcggctat
cagggcgatgcgagcgcgccctcggcagtgctgctgaagcacaacggcctgcacgtcgag
atccagatcgatgcgaacgacccgatcggcaagaccgacgccgcgcaggtaaaggacgtg
gtggtggaggcggcggtgagcaccatcatcgactgtgaagactccgtggcggccgtggat
gcagacgacaaggtccagctctatcgcaactggctcgggctgatgaacggcgatctgacg
gaagaggtcacgaaaaacggcaagaccttcacgcgccgtctgaacgcggatcgcgaatac
atcggcgcagacggcaagacgccggtcacgctgcatgggcgctcgctcctcttcatccgc
aacgtcggccacctgatgaccaatccggccgtgctgacgaaagacggcgcggagattccc
gaagggattctcgatgcagtgatcaccacgctgtgcgcgctgcacgatcgcaagaacaag
ctcaattcgcgcaccggctccatctatatcgtgaagccgaaaatgcacggcccggccgaa
gtggcgttcgcgagcgagctgtttgcgcgcgtcgaagacctgctcaagctgccgcgcaac
acgatcaagatgggcatcatggacgaggagcgccgcacgagcgtgaacctgctcgcgtgt
atcgcggaggccgcggagcgcgtcgcgttcatcaacacgggctttctcgatcgcaccggc
gacgagatgcatagcgcgatggaagctggcccgatgatgcgcaagggcgacatgaagtcg
agcacgtggattgcggcctatgagcgcagcaatgtgctcgtcggcttgcacgccgggctg
cgcggccgctcgcagatcggcaagggcatgtgggccatgcccgatctgatgcacgccatg
ctcgaacagaagatcggccatccgaaggccggcgcgaacaccgcgtgggtgccctcgccc
accgccgcgacgctgcatgcgctgcactatcaccaggtcgacgtgcaggcggttcagcag
gaactggagcgcacggagtacgcgaaggtgcgcgacgagctgctggacggtctgctgacc
attcccgtcgtcgaaaccgcgaagtggagcgccgacgaaattcgcgccgagctcgacaac
aacgcgcaaggcattctcggctacgtggtgcgctggatcgaccagggcgtgggctgctcg
aaggtgccggatattcacgacgtcggcctgatggaagaccgcgcgacgctgcgtatctcg
agccagcacatcgccaactggctgtatcacggcgtggtgacgcgcgagcaggtcgaagag
accttcaggcgcatggcgaaagtggtcgatcagcagaatgccgccgatcccttctacaag
ccgatggcgccgggtttcgacaccatcgcgttcaaggccgcgcaggcgctggtgttcgaa
ggacgccagcagccgagcggctacacggaaccgttgctgcacaagttccgtctcgcggtg
aagaaaggctga

DBGET integrated database retrieval system