KEGG   Burkholderia sp. CCGE1001: BC1001_1699Help
Entry
BC1001_1699       CDS       T01424                                 

Definition
Arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BC1001_1699
Enzymes [BR:bug01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BC1001_1699
   3.1.2  Thioester hydrolases
    3.1.2.-  
     BC1001_1699
Lipid biosynthesis proteins [BR:bug01004]
 Fatty acid synthase
  Component type
   BC1001_1699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1954572..1955273
Genome map
AA seq 233 aa AA seqDB search
MRVIKRRRANAIVRAAKSPAIGSLVLTAALFSTSFAAHAANTPEPAKPVIVVLGDSISAE
YGLPRDTGWVALLRQRLSEERIDYSVANASISGDTTSGGRARLPALMQRLKPSIVIVELG
ANDALRGVPLATTEDNLRTIIEEAQQGHAKVVLVGMYVPPNYGPDYTQKFHGIYGQLAKQ
LRVPLVPFLLAGIADKPEMFQADQIHPTQQAQPVLLNNVWPAVKPLLRTGSPR
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgttatcaaacgtcgtcgcgccaatgcaatcgttcgggcagcaaagtcgcccgca
atcggctctttggtattaaccgccgccctcttttcgacgagcttcgcggctcatgccgcc
aatacgccagaaccggcgaagcccgtcatcgtcgtattgggcgacagcatttccgccgaa
tatggcctgccacgcgacacgggctgggttgcgttgctgcgccagcgcctgagcgaggag
cgaatcgattatagcgttgcgaatgccagcattagcggcgacacgacgagcggcggacga
gcccgcttgcccgcgctcatgcaacgtttgaagccgagtatcgtgattgtcgaactgggc
gcgaacgacgcgttgcgtggcgtgccgctcgccacgaccgaggacaacctgcgcacgatc
atcgaagaggcgcagcaaggccatgcgaaggtcgtgctcgtcggcatgtacgtgccgcct
aactacggccccgactacactcaaaagttccacggcatttacggccagctcgcaaagcaa
ctgcgcgtgccgcttgtcccatttctgcttgcgggcattgccgacaagccggagatgttc
caggcggatcagattcatcccacccagcaggcacagccagtgctactcaacaacgtgtgg
cccgctgtgaagccactccttcgcacaggttcgccgcgctga

DBGET integrated database retrieval system