KEGG   Burkholderia sp. CCGE1001: BC1001_1800Help
Entry
BC1001_1800       CDS       T01424                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bug  Burkholderia sp. CCGE1001
Brite
Enzymes [BR:bug01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BC1001_1800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2065460..2066587)
Genome map
AA seq 375 aa AA seqDB search
MTNERAKRFPLGLEDLVREPRRPEGRPGEVRAAALAASAALNGRQQPTKNPQAGAASPAS
SGSAGKLQPKQGRAPTPLAAKPSVATPPKPLAAPAAKTSARPVAQSTSARPSAGARTAAA
GPSPARTAGKNAAPSAPPAKPAATRPNERSTGPNVALNGAMALTSERVRERMVERLRANG
VTDQRVLSAMSVVPRHMFVDPGLAVQAYEDAALPIGHHQTISKPSVVARMIELAAAGRAL
NNVLEIGTGCGYQAAVLSQVAREVYSIERIKPLSERAKTNLRPLRIPNIRLHYGDGRLGL
PSAAPFDAILIAAAGLDVPQALLEQLAIGGRLIAPVGSQEGHSQVLTLVERVGPAQWRES
QLDRVFFVPLKSGVI
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacgagcgcgcgaagcgcttcccgctcggcctcgaggatctggtgcgcgagccg
cgtcggcccgaaggccgcccgggggaggtgcgcgctgcggcgcttgccgcaagtgcggcg
ctcaatgggcggcagcagccgacgaaaaatccgcaggcaggtgcggcgagcccggcctcg
tcaggctcagcaggcaaattgcagccgaagcagggcagagcgcccacgccgcttgcggcc
aaaccgtccgtcgcgactccgccgaagccgcttgccgcgcccgcggcaaaaacatcggcg
cggccggtcgcgcagagcacgagcgcgcgcccgtctgccggcgccaggacggcagcggca
ggaccctcgcccgcgcgaaccgcaggcaagaacgccgcgccttctgcgccgcccgcgaag
cccgcggccacgcggccgaatgaacgcagcaccgggcccaacgtcgcgttgaacggcgcc
atggcgttgacctcggaacgggttcgcgaacgtatggtcgaacgcctgcgtgcgaacggc
gtcaccgatcagcgcgtgctgagcgcgatgtcggtggtgccgcgtcatatgttcgtcgac
cccgggctcgcggtccaggcgtacgaagacgccgcgctgcccatcgggcatcaccagact
atctcgaagccgtcggtggtcgcgcgcatgatcgagctcgcggcggcgggccgggccttg
aacaacgtgcttgaaatcggcaccggttgcggttatcaggcggcggtgctgagccaggtc
gcgcgcgaggtgtattcgatcgagcgcatcaagccgctatcggaacgcgcgaagacaaac
ttgcgtccgctgcgcattccgaacatccggctgcactatggcgacgggcgtttgggcttg
ccgtcggcggcgccttttgacgcgatcctgatcgccgcggcgggcctcgacgtgccgcag
gcattacttgaacaacttgcgatcggcggccgtctgattgcgcccgtcggctcgcaggaa
gggcacagccaggtgctgacgcttgtcgagcgtgtcggaccggcgcagtggcgggagtcg
cagcttgatcgcgttttctttgtacccttaaaatccggagtgatttga

DBGET integrated database retrieval system