KEGG   Burkholderia sp. CCGE1001: BC1001_1807Help
Entry
BC1001_1807       CDS       T01424                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bug03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2072955..2073551)
Genome map
AA seq 198 aa AA seqDB search
MKQPSALSALVEALRALPGVGPKSAQRMAYHLMQHDREGADKLGRALLFATEHLRHCEKC
NTFTEAQICEVCLDPERDPSLLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLDGIGPK
EIHFDRLVKRASDGVVKEVVLATNFTNEGEATAHYLGQTLKARGLAVTRLARGVPVGGEL
EYVDAGTIARAMLDRRSM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaccttccgccttgtcggcgctcgtcgaagcgctgcgcgcgctgcccggagtc
gggccgaagtccgcgcaacgcatggcgtaccacctgatgcagcacgaccgcgagggcgcc
gacaagctcggccgcgcgctgctgttcgcaactgagcatctgcggcactgcgagaagtgc
aatacctttaccgaggcgcagatctgcgaggtgtgcctcgaccctgagcgcgatccgagc
ttgctgtgcgtcgtcgaaacgcccgccgaccagatcatgctcgagcagaccatgacctac
cgcgggctctatttcgtgctgatgggccggctgagtccgctcgacggcatcggccccaag
gagatacatttcgaccggctggtgaaacgcgcgtccgacggtgtcgtaaaggaagtcgtg
ctcgccaccaatttcaccaacgaaggcgaagccaccgcgcattacctcgggcaaacgctc
aaggcgcgcgggcttgccgtcacgcgtctcgcccgcggcgtgccggtgggcggtgaactg
gaatacgtcgacgcgggcacgatcgcccgtgccatgctcgaccgccgctccatgtag

DBGET integrated database retrieval system