KEGG   Burkholderia sp. CCGE1001: BC1001_2178Help
Entry
BC1001_2178       CDS       T01424                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bug01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bug00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2470618..2471757
Genome map
AA seq 379 aa AA seqDB search
MSGTLALTEQLIARASVTPDDQHCQRLLIERLSALGFEHETIESNGVTNLWAVKRGVDGQ
AGKLLAFAGHTDVVPTGPLDQWHSAPFEPTHRDGKLYGRGAADMKSSIAGFVVASEEFVA
AHPQHRGSIAFLITSDEEGPATDGTVKVVEALQTRGERMDYCIVGEPTSSEQFGDTVKNG
RRGSMSGKLVVKGVQGHIAYPHLAKNPVHLLAPALADLVAERWDDGNEYFPPTTWQVSNI
HSGTGATNVIPGHAEVMFNFRFSTASTVEGLQQRVHAILDRHGLEYDLHWTVSGLPFLTP
HGELSNALAKAIKDETGVTTELSTTGGTSDGRFIARICQQVVEFGPLNASIHKIDEHIEV
AHIEPLKNVYRRVLEQLIA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcacccttgcccttaccgaacaactgatcgcgcgcgcttccgtcacgcccgac
gaccagcattgccagcgccttctgatcgaacgtctgtccgcgctcggcttcgagcacgaa
accatcgaatcgaacggcgtgacgaacctgtgggccgtgaaacgcggcgtggacggccag
gcgggcaagctgctcgcgtttgccggccacacggacgtggtgccgaccggcccgctcgat
caatggcattcggcgccgttcgaaccgacgcatcgcgacggcaagctgtacggccgcggc
gcggccgacatgaaaagctcgatcgccggcttcgtggtcgcgagcgaggagttcgtcgcg
gcgcacccgcagcatcgcggctcgatcgcgttcctgatcacgagcgacgaagaaggcccc
gccaccgacggcaccgtcaaggtggtcgaggccttgcagacgcgcggcgagcgcatggac
tactgcattgtcggcgagccgacttcgagtgagcagttcggcgatacggtgaaaaatggc
cggcgcggctcgatgtccggcaagctcgtcgtgaaaggcgtgcaaggccacattgcgtat
ccgcatctggcgaaaaatccggtgcatctgctcgcgcctgccctcgcggatctcgtcgcc
gaacgttgggacgacggcaacgaatacttcccgcccaccacgtggcaggtgtcgaacatc
catagcggcacgggcgcgaccaacgtgattcccggccatgccgaggtcatgttcaacttc
cgtttctcgacggccagcacggtggagggcttgcagcagcgcgtccacgcgatactcgac
cggcacggccttgaatacgatctgcattggaccgtgagcggcctgccgttcctcacgccg
cacggcgaactgtcgaacgcgctcgccaaagcgatcaaggacgaaaccggcgttaccacc
gaactatccaccaccggcggcacgtcggacggacgcttcatcgcgcgcatctgccaacag
gtggtcgagttcggcccgctgaacgcgagcatccacaagatcgacgaacatatcgaagtc
gcacacatcgagccgctgaaaaacgtgtaccgccgcgtgctcgaacaactgatcgcctga

DBGET integrated database retrieval system