KEGG   Burkholderia sp. CCGE1001: BC1001_2195Help
Entry
BC1001_2195       CDS       T01424                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1001_2195
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BC1001_2195
Enzymes [BR:bug01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BC1001_2195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2489959..2491266
Genome map
AA seq 435 aa AA seqDB search
MTTREEQARQLQQQWETDARWKGVKRSYTAEDVIRLRGSLQVEHTLAKRGAEKLWHSVNT
EPFVNSLGALTGNQAMQQVKAGLKAIYLSGWQVAGDANVAGEMYPDQSLYPANSVPLVVK
RINNTLTRADQIQWSEGKNPGDEGYIDYFAPIVADAEAGFGGVLNAFELMKAMIEAGAAG
VHFEDQLASVKKCGHMGGKVLVPTRENIAKLTAARLAADVCGVPTVLLARTDAEAADLIT
SDVDENDKPFLTGERTVEGFYRTKPGLEQAISRGLAYAPYADMIWCETGKPDLEFAKKFA
DAIHKEYPDQLLSYNCSPSFNWKKNLDDATIAKFQRELGAMGYKFQFITLAGFHALNYSM
FNLAHGYARNQMTAFVEMQQAEFAAAEKGFTAVKHQREVGTGYFDAVTQTVEREASTTAL
HGSTEDEQFFDKKVA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcgcgaagaacaagcccgccaacttcaacagcaatgggaaaccgatgcgcgc
tggaaaggcgtcaagcgcagctacacggccgaggacgtgatccgtctgcgcggctcgctg
caggtcgagcacacgctcgcgaagcgcggcgccgaaaaactctggcacagcgtgaacacc
gagccgttcgtcaactcgctcggcgcgctcaccggtaaccaggcgatgcaacaggtcaag
gccgggctgaaggcgatctacctgtcgggctggcaggtggcgggcgacgcgaacgtggcc
ggcgaaatgtatcccgaccagtcgctgtacccggcgaattcggtgccgctcgtcgtcaag
cgcatcaacaacacgctcacgcgcgccgaccagatccagtggtcggaaggcaagaatccg
ggcgacgaaggctatatcgactactttgcaccgatcgtcgccgatgccgaagccggtttc
ggcggcgtgctgaacgcgttcgaactgatgaaggccatgatcgaagccggcgccgccggc
gtgcacttcgaagaccaactcgcctcggtgaagaagtgcggccacatgggcggcaaggtg
ctcgtgccgacgcgcgaaaacatcgccaagctgacggccgcgcgtctcgccgccgacgtc
tgcggcgtgccgaccgtgctgctcgcccgcaccgatgccgaagccgccgacctgatcacc
tcggacgtggacgaaaacgacaagccgttcctgaccggcgagcgcaccgtcgaaggcttc
taccgcacgaagccgggtctcgaacaggcgatttcgcgcggcctcgcctatgcgccgtac
gccgacatgatctggtgtgaaaccggcaagccggacctcgagtttgcgaagaaattcgcc
gacgcgatccacaaggagtacccggatcaactgctgtcgtacaactgctcgccgtcgttc
aactggaagaagaatctcgacgacgcgaccatcgccaagttccagcgcgaactcggcgcg
atgggctacaagttccagttcatcacgctcgccggcttccatgcgctgaactactcgatg
ttcaacctcgcgcacggctacgcgcgcaatcagatgaccgcgttcgtcgagatgcagcag
gccgaattcgcggcggcggaaaagggcttcaccgccgtcaagcaccagcgcgaagtgggc
acgggctatttcgacgcggtcacgcagacggtggagcgcgaagcgtcgacgaccgcgctg
cacggctcgacggaagacgaacagttcttcgacaagaaagtcgcgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system