KEGG   Burkholderia sp. CCGE1001: BC1001_2199Help
Entry
BC1001_2199       CDS       T01424                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1001_2199
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BC1001_2199
   00630 Glyoxylate and dicarboxylate metabolism
    BC1001_2199
Enzymes [BR:bug01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BC1001_2199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2494135..2495736
Genome map
AA seq 533 aa AA seqDB search
MANSQSSLSLPQGVAITGEIKPGYEAILTREALELVAALHRTFEPRRQQLLQARAERTKR
LDAGERPDFLAETKSVRESDWTIAPLPHDLQRRRVEITGPVERKMIINALNSGADSYMTD
FEDSNAPSWDNQITGHINLKDAVRRTISLEQNGKHYKLNDTIATLIVRPRGWHLDEKHVS
VDGKRVSGGIFDFALFMVHNAKELIARGSGPYFYLPKMESHLEARLWNDIFVAAQEAVGV
PRGTIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKADRDFCLADR
SQITMTSPFMRAYALLLLKTCHRRNAPAIGGMSALIPIKNDPAANDKAMAGVRSDKARDA
GDGYDGGWVAHPGLVPIAMEEFVKVLGDKPNQIGKQRDDVLVTATDLLDFRPETPITEAG
LRNNINVGIHYLGSWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGTLDDGRKVTA
ELVRELAVQELDKVKQAVGGDTAPYERAAQIFEQMSTSAQFTDFLTLPLYEEI
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggcgaattcgcagtcatcgttgtcgctgccgcagggcgtggcaatcaccggcgaaatc
aaaccgggttatgaagcaattctgacccgcgaggcgctcgaactcgtcgccgcgctgcat
cgcaccttcgagccgcgccgtcagcagctgctgcaggcgcgcgcggaacgcacgaagcgt
ctcgacgcgggcgagcgccccgacttcctcgccgagacgaagagcgtgcgcgagagcgac
tggaccatcgcgccgctgccgcacgacctgcaacgccgccgcgtcgaaatcacggggccg
gtggagcgcaagatgatcatcaacgcgctgaactccggcgcggattcgtacatgaccgac
ttcgaggattcgaatgcgccgagctgggacaaccagatcaccggccatatcaacctgaag
gacgccgtgcgccgcaccatttcgctggagcagaacggcaagcactacaagctgaacgac
accatcgccacgctgatcgtgcgcccgcgcggctggcatctcgacgaaaagcacgtgagc
gtggacggcaagcgcgtgtccggcggcatcttcgacttcgcgctcttcatggtgcataac
gcgaaggaactgatcgcgcgcggctcgggcccctacttctatctgccgaagatggaaagc
cacctcgaggcgcgtctgtggaacgacatcttcgtcgctgcacaggaagcggtcggcgtg
ccgcgcggcacgattcgcgcgacggtgctgatcgaaaccattctcgccgcgttcgaaatg
gacgaaatcctgtacgagctgcgcgaacacagctcgggcctgaacgcgggccgctgggac
tacatcttctcggcgatcaagaagttcaaggccgaccgcgacttctgcctcgcagaccgc
tcgcagatcacgatgacctcgcccttcatgcgcgcctatgcgctgttgctgctgaagact
tgccaccgccgcaatgcgccggctatcggcggcatgagcgcgctgattccgatcaagaac
gacccggctgcgaacgacaaggcgatggccggcgtgcgctcggacaaggcgcgcgatgcg
ggcgacggctacgacggcggctgggttgcgcacccggggcttgtgcccatcgcaatggaa
gaattcgtcaaggtgctcggggacaaaccgaaccagatcggcaagcaacgcgacgacgtg
ctcgtcaccgcgacggatctgctcgacttccgcccggagacgccgattaccgaagccggt
ttgcgcaacaacatcaacgtcggcattcactacctgggttcgtggctcgcgggcaatggc
tgcgtgccgatccacaatctgatggaagacgccgcgaccgccgagatttcgcgctcgcag
gtgtggcaatggatccgctcgccgaagggcacgctcgacgacggccgcaaggtgaccgct
gaactggtgcgcgagctggccgtgcaggaactcgacaaggtgaagcaggcggtgggcggc
gataccgcgccgtacgagcgcgccgcgcaaatcttcgagcagatgtcgacgtccgcgcag
ttcacggacttcctgacgctgccgctctacgaagaaatctga

DBGET integrated database retrieval system