KEGG   Burkholderia sp. CCGE1001: BC1001_2303Help
Entry
BC1001_2303       CDS       T01424                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:bug01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bug00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bug00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bug00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2616289..2617608)
Genome map
AA seq 439 aa AA seqDB search
MSQAIEVKVPDIGDYKDIPVIEVLVKAGDTVEKEQSLVTLESDKATMDVPSSAAGVVKEV
KVKVGDTVSEGSVIVVVEAEGGAAAPAPAPAAAPKHEAEKPSDAPVAPSPAPASPSALAQ
APLIPAGEGGTRRISHASPSVRKFARELGVDVTQVQGTGPKGRITQADVTAFIKGVMTGQ
RAAPAGAAAPAAAGGELNLLPWPKVDFSKFGPFEAKPLSRIKKISGANLHRNWVMIPHVT
NNDEADITELEALRVQLNKENEKAGVKITMLAFVIKAVVSALKKFPTFNASLDGDNLVFK
QYYHIGFAADTPNGLVVPVIRDADKKGLVEIAKEMTDLSKAAREGKLKPDQMQGGCFSIS
SLGGIGGTNFTPIINAPEVAILGLSRGAMKPVWDGKQFVPRLTLPLSLSYDHRVIDGAEA
ARFNAYLGSILADFRRVIL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgatcgaagtcaaggtgccggacatcggcgattacaaggacattcctgtg
atcgaggtgctggtcaaggcgggtgacaccgtcgagaaagagcagtcgctcgtgacgctg
gaatccgacaaggcgaccatggacgtgccgagctcggccgccggcgtcgtcaaggaagtg
aaggtcaaggtcggcgataccgtgtcggaaggctcggtgatcgtcgtggtggaagccgaa
ggcggtgcggcagcgcccgcgccggcacccgccgccgcgccgaaacacgaagccgagaaa
ccgtcggacgcgcccgtcgcgccgtcgcccgcaccggcctcgccgtccgcgctcgcgcag
gcgccgctgattccggcaggcgagggcggcacgcgccgcatcagccacgcttcgccttcg
gtgcgcaagttcgcgcgcgaactgggcgttgacgtgacgcaagtgcagggcacgggtccg
aagggccgcatcacgcaagccgacgtcaccgcgttcatcaagggcgtcatgacgggccag
cgcgcggcgcccgccggtgctgccgcgcctgcggcggcgggcggcgagctgaacctgctg
ccgtggccgaaggtcgacttctcgaagttcggcccgttcgaggccaagccgctgtcgcgc
atcaagaagatttccggcgcgaacctgcaccgcaactgggtgatgatcccgcacgtcacg
aacaacgacgaagcggatatcaccgagctcgaagcgctgcgcgtgcagttgaacaaggaa
aacgaaaaggccggcgtgaagatcacgatgctggcgttcgtgatcaaggcggtcgtgtcg
gcgctgaagaagttcccgaccttcaacgcgagcctcgacggcgacaacctcgtgttcaag
cagtactaccacatcggttttgctgcggacacgcccaacggtctcgtcgttccggtgatt
cgcgacgcggacaagaagggcctcgtcgagatcgcgaaggaaatgaccgacctgtcgaag
gctgcgcgcgaaggcaagctcaagcccgatcagatgcaaggcggctgcttctcgatttcg
tcgctgggcggcattggcggcacgaacttcacgccgatcatcaacgcacccgaagtcgcg
attctcggtttgtcgcgcggcgcgatgaagccggtgtgggacggcaagcagttcgtgccg
cgtctgacgctgccgctgtcgctgtcgtacgaccatcgtgtgatcgacggtgctgaggct
gcgcggttcaatgcgtatcttgggtcgattcttgccgattttcggcgtgtgattctttga

DBGET integrated database retrieval system