KEGG   Burkholderia sp. CCGE1001: BC1001_2303Help
Entry
BC1001_2303       CDS       T01424                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00010  Glycolysis / Gluconeogenesis
bug00020  Citrate cycle (TCA cycle)
bug00620  Pyruvate metabolism
bug01100  Metabolic pathways
bug01110  Biosynthesis of secondary metabolites
bug01120  Microbial metabolism in diverse environments
bug01130  Biosynthesis of antibiotics
bug01200  Carbon metabolism
Module
bug_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1001_2303
   00020 Citrate cycle (TCA cycle)
    BC1001_2303
   00620 Pyruvate metabolism
    BC1001_2303
Enzymes [BR:bug01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BC1001_2303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DEC-1_N RnfC_N HlyD_D23 CAT HlyD_3
Motif
Other DBs
NCBI-ProteinID: ADX55720
JGI: BC1001_2303
UniProt: E8YIW0
Position
1:complement(2616289..2617608)
Genome map
AA seq 439 aa AA seqDB search
MSQAIEVKVPDIGDYKDIPVIEVLVKAGDTVEKEQSLVTLESDKATMDVPSSAAGVVKEV
KVKVGDTVSEGSVIVVVEAEGGAAAPAPAPAAAPKHEAEKPSDAPVAPSPAPASPSALAQ
APLIPAGEGGTRRISHASPSVRKFARELGVDVTQVQGTGPKGRITQADVTAFIKGVMTGQ
RAAPAGAAAPAAAGGELNLLPWPKVDFSKFGPFEAKPLSRIKKISGANLHRNWVMIPHVT
NNDEADITELEALRVQLNKENEKAGVKITMLAFVIKAVVSALKKFPTFNASLDGDNLVFK
QYYHIGFAADTPNGLVVPVIRDADKKGLVEIAKEMTDLSKAAREGKLKPDQMQGGCFSIS
SLGGIGGTNFTPIINAPEVAILGLSRGAMKPVWDGKQFVPRLTLPLSLSYDHRVIDGAEA
ARFNAYLGSILADFRRVIL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgatcgaagtcaaggtgccggacatcggcgattacaaggacattcctgtg
atcgaggtgctggtcaaggcgggtgacaccgtcgagaaagagcagtcgctcgtgacgctg
gaatccgacaaggcgaccatggacgtgccgagctcggccgccggcgtcgtcaaggaagtg
aaggtcaaggtcggcgataccgtgtcggaaggctcggtgatcgtcgtggtggaagccgaa
ggcggtgcggcagcgcccgcgccggcacccgccgccgcgccgaaacacgaagccgagaaa
ccgtcggacgcgcccgtcgcgccgtcgcccgcaccggcctcgccgtccgcgctcgcgcag
gcgccgctgattccggcaggcgagggcggcacgcgccgcatcagccacgcttcgccttcg
gtgcgcaagttcgcgcgcgaactgggcgttgacgtgacgcaagtgcagggcacgggtccg
aagggccgcatcacgcaagccgacgtcaccgcgttcatcaagggcgtcatgacgggccag
cgcgcggcgcccgccggtgctgccgcgcctgcggcggcgggcggcgagctgaacctgctg
ccgtggccgaaggtcgacttctcgaagttcggcccgttcgaggccaagccgctgtcgcgc
atcaagaagatttccggcgcgaacctgcaccgcaactgggtgatgatcccgcacgtcacg
aacaacgacgaagcggatatcaccgagctcgaagcgctgcgcgtgcagttgaacaaggaa
aacgaaaaggccggcgtgaagatcacgatgctggcgttcgtgatcaaggcggtcgtgtcg
gcgctgaagaagttcccgaccttcaacgcgagcctcgacggcgacaacctcgtgttcaag
cagtactaccacatcggttttgctgcggacacgcccaacggtctcgtcgttccggtgatt
cgcgacgcggacaagaagggcctcgtcgagatcgcgaaggaaatgaccgacctgtcgaag
gctgcgcgcgaaggcaagctcaagcccgatcagatgcaaggcggctgcttctcgatttcg
tcgctgggcggcattggcggcacgaacttcacgccgatcatcaacgcacccgaagtcgcg
attctcggtttgtcgcgcggcgcgatgaagccggtgtgggacggcaagcagttcgtgccg
cgtctgacgctgccgctgtcgctgtcgtacgaccatcgtgtgatcgacggtgctgaggct
gcgcggttcaatgcgtatcttgggtcgattcttgccgattttcggcgtgtgattctttga

DBGET integrated database retrieval system