KEGG   Burkholderia sp. CCGE1001: BC1001_2447Help
Entry
BC1001_2447       CDS       T01424                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BC1001_2447
   00052 Galactose metabolism
    BC1001_2447
   00500 Starch and sucrose metabolism
    BC1001_2447
   00520 Amino sugar and nucleotide sugar metabolism
    BC1001_2447
Enzymes [BR:bug01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BC1001_2447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2795665..2796546
Genome map
AA seq 293 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAMAAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKDKLLELVRSIKPSHVDCFYVRQPEALGLGHAVLCAEK
LVGDNPFAVILADDLLYGTPPVMTQMIEVFDHYHSSVIGVEEIPPQDTRSYGIVDGKEWE
DSIIKMSGIVEKPEPSVAPSNLGVVGRYVLKPRIFDHIRSLKPGAGGELQLTDAIQSLLA
DEQVLAYKYHGTRFDCGSKLGYLKATVEFALRHPEVAADFEEYLRTRSPVLEG
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaagttacaaaggcggtatttccggtagcaggtcttggcacccggttcctccct
gccacgaaggcaagcccgaaggaaatgctgccgatcgtcgacaagccgctgattcaatac
gcggtggaagaagcgatggcggccggcatcaccgaaatgatcttcgtcacgggccgcagc
aaacgggcgatcgaggaccatttcgacaagtcatacgaaatcgaagccgagctcgaggca
cgcggcaaggacaagctgctggaactcgtgcgcagcatcaagccgagtcacgtcgactgt
ttctacgtgcgtcagcccgaagcgctcggcctcggccacgccgtgctgtgcgcagagaag
ctggtgggcgacaacccgttcgccgtgattctcgcggacgacctgctgtacggcacgccg
cccgtcatgacgcagatgatcgaggtgttcgaccactatcacagctcggtgatcggcgtc
gaagaaatcccgccgcaggacaccaggtcgtacggtattgtcgacggcaaggaatgggaa
gactcgatcatcaagatgtcgggcatcgtcgagaagccggagccgagcgtcgcgccgtcc
aatctcggcgtggtgggccgttatgtgctgaagccgcgcattttcgaccacattcgctcg
ctcaagccgggcgccggcggcgaactgcagctcacggacgccatccagtcgctgctcgcc
gacgaacaggtgctcgcatacaagtatcacggcacgcgtttcgactgcggcagcaagctc
ggctatctgaaggcgacggtggaattcgcgctgcgccatccggaagtggccgcggatttc
gaggaatacctgcgtacgcgctcgccggtgctggaaggctaa

DBGET integrated database retrieval system