KEGG   Burkholderia sp. CCGE1001: BC1001_2531Help
Entry
BC1001_2531       CDS       T01424                                 

Definition
glycoside hydrolase family 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bug00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bug00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2895789..2896817)
Genome map
AA seq 342 aa AA seqDB search
MKTIPGPVMLDVVGKTLNDDDKRRLAHPMTGGVILFARHYESRAQLIALTDSIRAIRQDL
LIAVDHEGGRVQRFRTDGFTVLPAMGKLGALWDSDVLHATKVATAVGYILASELRACGID
MSFTPVLDLNYGQSQVIGDRAFHSDPRVVTLLAKSLNHGLALAGMSNCGKHFPGHGFAHA
DSHVAMPVDDRSLDDILRDDVAPYDWLGLALGSVIPAHVVYPQVDSKPAGFSRVWLQDIL
RGKLRFEGAIFSDDLSMEAARQGGTLTEGATAALQAGCDMVLICNQPDQAEKVLDELRFT
PSKESQQRLKRMRARGKPLKWSKLIAQPQYLQAQALLRSVFA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccattcccggaccggtcatgctcgacgtggtcggcaaaacgctgaacgacgac
gacaagcgccgccttgctcacccgatgaccggcggcgtgatcctgttcgcgcgccactac
gaaagccgcgcgcaactcatcgcgttgactgattcgatccgcgcgattcgccaggatctg
ctgattgccgtcgatcacgaaggcgggcgcgtgcagcgcttccgcacggacggcttcacg
gtgcttccggccatgggcaagctcggcgcgctatgggacagcgacgtgctgcatgccacc
aaggtcgccactgcggtcggctatatccttgcatcggagctgcgcgcttgcgggatcgac
atgagctttacgccagtgctcgacctgaactacggtcagtcgcaggtgatcggcgatcgc
gcgttccacagcgatccgcgcgtggtgacgctgctcgcgaaaagcctcaaccacggtctt
gcgcttgccggcatgagcaactgcggcaagcatttcccggggcatggtttcgcgcatgcg
gattcgcacgtcgcgatgcctgtcgacgaccgttcgctcgacgacatcctgcgcgacgac
gtcgcgccttatgactggctaggcctcgcgctcggctcggtgattccggcgcatgtggtg
tatccgcaagtcgattcgaagccggcgggtttttcgcgcgtgtggctgcaggacattctg
cgcggcaagctgcgtttcgagggcgcgattttcagcgacgacctctcgatggaagccgcg
cgccagggcggcacgctcaccgaaggcgcgactgccgcgctgcaagccggctgcgacatg
gtgctgatctgcaatcagcccgaccaggctgaaaaggtgctggacgagttgcgctttacg
ccgtcaaaggaatcgcagcagcgcttgaagcgcatgcgggcccgcggcaagccgctcaag
tggagcaagctgatcgcgcagccgcagtatctgcaagcgcaggcgctgctgcgcagcgtg
ttcgcctga

DBGET integrated database retrieval system