KEGG   Burkholderia sp. CCGE1001: BC1001_2966Help
Entry
BC1001_2966       CDS       T01424                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bug00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3375401..3376900
Genome map
AA seq 499 aa AA seqDB search
MQDQYILALDQGTTSSRAMLFDRLGNVVSTAQKEFEQIYPRPGWVEHDPQEIWSTQAGVA
AEAVTRAGMNGSSIAAIGITNQRETTIVWDRETGHPIYNAIVWQDRRTADFCDQLKEQGL
EAKVRAKTGLPIDSYFSATKIRWILDNVEGAREKAKRGRLAFGTVDSWLVWNFTKGGLHF
TDVTNASRTMLFNIHTLKWDDELLEALDIPRSMLPEVRASSDVYGPTKTTVFASKIPLAG
IAGDQHAALFGQMCTQSGMVKNTYGTGCFLVMNTGDKPIESKNNLVTTIAWQIGDQINYA
LEGSIFIGGAVVQWLRDGLGIIKHAAEIEALAASVPHCDGVYLVPAFAGLGAPHWNARAR
GTLFGVTRGTTSAHIARAALDSIAYQSLDVLKAMEADSGIRIGELRVDGGACANNLLMQF
QADILGVDAVRPKVSETTALGAAYLAGLAVGYWKDVDELQSQWKLDRRFTPAREQADVQE
CLDGWKRAIRAAKAWADTP
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatcagtacatcctcgcgcttgaccagggcaccaccagctcacgtgcgatgctg
ttcgaccgcctcggcaatgtcgtgtcgacggcgcaaaaggaattcgagcagatctatccg
cgtccgggctgggtcgagcacgacccgcaggaaatctggtcgacgcaggccggcgtcgcc
gccgaggccgtgacgcgcgccggcatgaacggctcgtcgatcgccgcgatcggcattacg
aatcagcgcgaaaccaccatcgtgtgggaccgcgaaaccgggcaccccatctacaacgcc
atcgtgtggcaagaccgccgcaccgccgacttctgcgaccagctcaaggaacagggcctc
gaggcgaaggtgcgcgcgaaaaccggcttgccgatcgactcgtatttctcggcgaccaag
atccgctggattcttgataacgtcgaaggcgcgcgcgagaaggcaaagcgaggccgactc
gcgttcggcacggtggacagctggctcgtgtggaatttcaccaagggcggcctgcacttc
accgacgtcaccaatgcctcgcgcacgatgctcttcaacatccacacgctgaagtgggac
gacgaactgctcgaggcgctcgacattccgcgcagcatgttgccggaagtgcgggcgtcg
tcggacgtgtatgggccgaccaaaacgacggtgttcgcgtcgaagattccgctcgcgggc
atcgccggcgaccagcatgccgcgcttttcggccagatgtgcacgcaatccggcatggtg
aagaacacctacggcaccggctgcttcctcgtgatgaacaccggcgacaagccgatcgag
tcgaagaacaatctcgtcacgacgattgcctggcaaatcggcgaccagatcaactacgcg
ctcgaaggcagcatcttcatcggcggcgcggtcgtgcaatggctgcgcgacggtctcggc
atcatcaagcatgccgctgaaatcgaggcgctcgcggcgagcgtgccgcattgcgacggc
gtctacctcgtgcctgcattcgccggcctcggcgccccgcactggaatgcacgcgctcgc
ggcacgctgttcggcgtgacgcgcggcacgacgtccgcgcatatcgcgcgcgccgcgctc
gactcgatcgcctatcagtcgctcgacgtgctgaaggccatggaggccgactcgggcatt
cgcatcggcgaattgcgggtggacggcggcgcgtgcgcgaacaatctgctgatgcagttc
caggcggacattctcggcgtggacgcggtccgcccgaaggtgtcggaaaccaccgccctc
ggcgcggcgtatctggcgggcctcgcggtcggctactggaaagacgtcgacgaactgcaa
agccagtggaagctcgaccggcgcttcacgcccgcgcgcgagcaggcggacgtgcaggaa
tgtctggacggctggaagcgcgcgattcgcgccgccaaggcatgggccgacacgccctga

DBGET integrated database retrieval system