KEGG   Burkholderia sp. CCGE1001: BC1001_2989Help
Entry
BC1001_2989       CDS       T01424                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bug03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3399849..3400430
Genome map
AA seq 193 aa AA seqDB search
MIGRIAGVLLEKNPPHLLVDCNGVGYEVDVPMSTFYNLPSTGERVVLLTQMIVREDAHLL
YGFGTAEERSTFRELLKISGIGARMALAVLSGMSVHELSQTVTLQDAARLTRVPGIGKKT
AERLLLELKGKLGADLGVMAGAVSASDHASDILNALLALGYSEKEALAAIKNVPAGTGVS
EGIKLALKALSKA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcattgccggcgttctgctggaaaaaaacccgccgcatctgctcgtcgac
tgcaacggcgtcggttacgaagtcgatgtgccgatgagcactttctacaacctgccttcc
accggcgagcgggtcgtgctgctcacgcagatgatcgtgcgcgaagacgcgcatctgctg
tacggcttcggcaccgccgaggaacgctccaccttccgcgagctgctcaaaatttccggc
atcggcgcgcgcatggcgctcgccgtgctctcgggcatgagcgtccacgaactttcgcag
acggtcacgctgcaggacgccgcacgcctcacgcgggtgccgggcattggcaagaaaacc
gccgagcggctgctgctcgaactcaagggcaagctcggcgcggacctgggcgtcatggcc
ggcgcggtgtcggcatccgaccacgcttccgacattctcaacgcgctgctcgcgctcggc
tattcggagaaggaagcgttggcggcgatcaagaacgtgccggccggcacgggcgtgtcc
gagggcatcaagctcgcgctgaaggccttgtccaaggcctga

DBGET integrated database retrieval system