KEGG   Burkholderia sp. CCGE1001: BC1001_3039Help
Entry
BC1001_3039       CDS       T01424                                 

Definition
guanine-specific ribonuclease N1 and T1
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
bug  Burkholderia sp. CCGE1001
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3463437..3463853)
Genome map
AA seq 138 aa AA seqDB search
MARRWQRIKGVLIGAVALCAWCGPVPQAFARNYNAPAGTQAQAEGTVAVAQLPREAVNTL
NLIAAGGPYPYEKDGVVFGNRERLLPPNRRGYYHEYTVPTPRSRNRGARRIVCGGPLKRT
DNCYYSDDHYTSFNRIVE
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaggtggcagcgcatcaagggcgtgctgatcggtgctgttgcgctgtgcgct
tggtgcggccccgtgccacaagcgttcgcgcgcaactacaacgcacctgccggcacgcag
gcacaggcagagggcaccgtcgcggtggcgcaactgccccgcgaggccgtcaatacattg
aacttgattgccgcgggcgggccttacccgtatgaaaaggacggcgtcgtgttcggcaac
cgcgaacggttgctgccgcccaaccggcgcggctactaccacgaatacaccgttcccacg
cctcgctcacgcaatcgcggggcgcgtcgcatcgtctgcggaggtccgctgaagcgaacc
gacaattgttattactcggacgaccactacaccagttttaatcgtattgttgaatga

DBGET integrated database retrieval system