KEGG   Burkholderia sp. CCGE1001: BC1001_3114Help
Entry
BC1001_3114       CDS       T01424                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bug00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bug00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3544053..3545612)
Genome map
AA seq 519 aa AA seqDB search
MSALRQHHPAHQQIADALQWLRARVQPGAHLHADTRSLAAGDAFFAYAVEGADNRPFIDG
ALERGAAAVLVQPEGFGGAIDASTMLAVPALNELAGSIASAWYGDPSDSMLTVGVTGTNG
KTSCSQWISAALTALGTRCAIIGTLGTGLPGQLVHTGFTTPDAPQLQRSLAQLRHAGAKA
VAMEVSSHALHQGRVNGTAFDIAVFTNLTQDHLDYHHTFEAYEAAKARLFAWPELRAAVI
NRDDAAGRRLLASTRGHARTIAYGLDSASKGTPDSTPQADALLLASNVRATATGTAFHLS
TSDWGDADVEVQTLGAFNVSNLLGVLGALLAADVPFDAALAELARLESVNGRMQRLGGRL
QNDEPLVVIDYAHTPDALEKTLEALRPMAAARGGELVCMFGCGGDRDATKRPLMGAIAEK
LADGVVVTSDNPRSEDPQSIIEQIAAGMKDASKARRIEDRASAILQAIRGAAREDVIVLA
GKGHEATQEIMGKKRAFSDQDHARLALAARATQARGGGE
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgctccgccagcaccatcccgcgcatcagcagattgccgacgcgttgcagtgg
ctgcgcgcacgcgtgcagccgggcgcgcatctgcatgccgacacgcgttcgctcgcagcc
ggcgacgcgtttttcgcctacgcggtggagggcgcggacaaccgcccgttcatcgacggc
gcgctagaacgcggcgctgccgcggtgctcgtccagccggaaggtttcggcggcgcgatc
gacgcatccacgatgctcgcggtgccggcgttgaacgagctcgccggttcgatcgcgagc
gcgtggtacggcgatccgagcgacagcatgctcacggtcggcgtcaccggcacgaacggc
aagacctcgtgcagccagtggatttcggcggcgctgactgcgctcggcacgcgctgcgcg
atcatcggcacgctcggcacgggtttgccggggcaactcgtgcacaccggcttcacgacg
cccgacgcgccgcaattgcagcgcagtcttgcgcagttgcgccacgccggcgccaaggcg
gtggcgatggaagtgtcgtcgcacgcgctgcatcagggccgcgtgaacggcacggcgttc
gacattgccgtgttcacgaatctcacgcaagaccatctggactaccaccacacgttcgag
gcctacgaggccgcgaaggcgcgccttttcgcgtggcccgaactccgcgcggccgtgatc
aaccgcgacgacgcggcgggccgccgtttgctcgcgagcacgcgcggccacgcacgcacc
atcgcatacggccttgattcggcgtcgaaaggcacgccggacagcacgccgcaggccgac
gcgttgctgctcgcgtcgaacgttcgcgcgactgccacgggcaccgcgttccacctgagc
acgtccgattggggcgacgcggatgtcgaagtgcaaaccctcggcgcgttcaacgtgagc
aatctgctcggcgtactcggcgcgctgcttgccgccgacgtcccgttcgacgccgcgctc
gccgagctggccaggctcgagtcggtgaacggccgcatgcagcgtctcggcggccgcttg
cagaacgacgagccgctcgtcgtgatcgactacgcacacacgccggacgcgctcgaaaaa
accctcgaagcattgcggccgatggcggccgcgcgcggcggcgaactcgtctgcatgttc
ggctgcggcggcgatcgcgacgcgaccaagcgcccgctgatgggtgcgattgccgaaaag
ctggcggacggcgtcgtcgtcacaagcgacaacccgcgcagcgaagacccgcaatcgatc
atcgaacagatcgccgccggcatgaaggacgcgtcgaaggcgcgccgcatcgaagatcgc
gcgagcgcgatcctgcaggcgatccgcggcgccgcgcgcgaagacgtcattgtgctggcc
ggcaaggggcacgaagcaacacaggaaatcatgggcaagaagcgcgctttctccgaccag
gaccacgcccggctcgcgctcgccgcgcgggcgacgcaggcacgcggagggggcgaatga

DBGET integrated database retrieval system