KEGG   Burkholderia sp. CCGE1001: BC1001_3138Help
Entry
BC1001_3138       CDS       T01424                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bug01100  Metabolic pathways
bug01110  Biosynthesis of secondary metabolites
bug01130  Biosynthesis of antibiotics
bug01230  Biosynthesis of amino acids
Module
bug_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BC1001_3138
Enzymes [BR:bug01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BC1001_3138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C PIG-X
Motif
Other DBs
NCBI-ProteinID: ADX56552
JGI: BC1001_3138
UniProt: E8YG12
Position
1:3577310..3578107
Genome map
AA seq 265 aa AA seqDB search
MSDILDRIIAVKREEVRAAEQSAPLEELRLEASSRDIRDFVGALRAKHAAGLAAVIAEVK
KASPSKGVLREDFVPAQIARSYEQHGAACLSVLTDVQFFQGSVAYLEQARAACQLPVLRK
DFIVDPYQIVEARAMGADAILLIAAALETSQMQDLEALAHSLGLAVLVEVHDREELMEAL
TLKTPLIGINNRNLRTFETSIETTIGMLEAIPDDRIVVTESGILGRADVERLRAKDVNTF
LVGEAFMRADEPGVELARMFFPGAA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacattctcgaccgtatcatcgcggtcaaacgcgaagaagtccgcgcggccgaa
caaagcgccccgctcgaagagctgcgcctcgaagcttcttcgcgcgacattcgcgatttc
gtcggtgcattgcgcgcgaagcacgcagcggggcttgccgctgtgatcgccgaagtgaag
aaggcgagcccctccaaaggcgtgctgcgcgaagacttcgtgcccgcgcagatcgcgcgt
tcttacgagcagcacggcgcggcctgcctgtccgtgctgaccgacgtgcagttctttcag
ggcagcgtcgcgtatctggaacaggcgcgcgccgcctgccagttgccggtgctgcgcaag
gacttcatcgtcgatccgtaccagatcgtcgaggcgcgcgccatgggcgcggacgcgatc
ctgctgatcgccgccgcgctcgaaacctcgcagatgcaggatctcgaagcgctcgcgcat
tcgctcgggcttgccgtgctcgtcgaagtacacgaccgcgaagagctgatggaggcgctc
acgctgaaaacgccgctcatcggcatcaacaatcgcaatctgcgcaccttcgagacgtcg
atcgaaacgacaatcggcatgctcgaggccattcccgacgaccgtatcgttgtaacggaa
tcgggcattctggggcgagcggatgtcgaacggctgcgcgcgaaggacgtgaatacgttc
ctcgtcggcgaggcgttcatgcgcgccgacgagccgggcgtggagcttgctcgcatgttc
tttcccggcgcggcgtga

DBGET integrated database retrieval system