KEGG   Burkholderia sp. CCGE1001: BC1001_3626Help
Entry
BC1001_3626       CDS       T01424                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BC1001_3626
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BC1001_3626
Enzymes [BR:bug01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     BC1001_3626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(24595..26988)
Genome map
AA seq 797 aa AA seqDB search
MAEAISRPAPPHTLDPDTLQRMDRYWRACNYLSAGMIYLRDNPLLREPLKPEHIKNRLLG
HWGSDPGQSFLLVHLNRLIKKLDLNVIYISGPGHGAPATLAHCYLEGHYSEIYPDRSEDE
AGMRRLFRQFSFPGGIGSHCTPETPGSIHEGGELGYSLSHGYGAAFDNPDLIVAVMIGDG
EAETGPLATSWHSNKFLNPVRDGAVLPVLHLNGYKIANPTLLARIPREELEALLTGYGHK
PYFVEGDDPAVMHQQMAATLEQCIGEIRAIQQHARANHDATRPRWPMIVLRSPKGWTGPK
EVDGHKVEGSWRAHQVPIADPATNRESLKLVEAWLRSYEPESLFDENGRLVEALRELAPQ
GERRISANPHANGGVLCKMLDMPAFRDYAVEVKQHASAYSSPTQVLGQFLRDVMRRNMSN
FRVFGPDETASNKLTAIYEASGKTWLADAQPNDADGGALSADGRVMEMLSEHTLEGWFEG
YVLTGRHGLFATYEAFVHVIDSMFNQHAKWLEKAKRELRWRQPVPSINLLITSLVWRQDH
NGFTHQDPGFLDVVTNKSPDVVRIYLPPDTNCLLSVADHCLRSRDYVNVIVSDKQPHLQY
LDMEAAVTHCTKGIGIWDWASTDQGAEPDVVMACAGDIATMEALAAVQILKARFPDLKIR
FVNVVDLFRLMPEHAHPHGLSGRDFDSLFTTSKPVIFNFHSYASLVHKLTYSRTNHDNLH
VHGYHEKGNINTPLELAIINQVDRFSLAIDVIDRVPRLRGVGDHTKEWLRGQIIEHLAYA
HAEGIDKEEIRNWTWQD
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcaatctcccgtcccgccccgccgcacactttagaccccgacacgctgcag
agaatggatcgctactggcgcgcgtgcaactacctgtcggccggcatgatctatctgcgc
gacaacccgctgctgcgcgaaccgctgaagcccgaacacatcaagaaccgtctcctcggg
cactggggctcggaccccggccaaagctttttgctcgtgcacctgaaccgcctcatcaag
aagctcgacctgaacgtgatctacatttcggggccagggcacggcgcgcctgccacgctg
gcccactgctatctggagggacattactcggaaatctatcccgaccgcagcgaagacgag
gccggcatgcggcgccttttccggcaattctcgtttcccggcggcatcggctcgcattgc
acgccggaaacgccgggctcgattcatgaaggcggcgagctcggctacagcctgtcgcac
ggctatggcgcggcgttcgacaacccggatctgatcgtcgcggtgatgatcggcgacggc
gaagccgagaccgggccgctcgccacctcgtggcattcgaacaagttcctgaacccggtg
cgcgacggcgcggtgctgccggtgctgcatctgaacggctacaagatcgccaacccgacg
ctgctcgcgcgcattccgcgcgaggaactcgaagcgctgctcaccggttacggccacaaa
ccgtatttcgtcgaaggcgacgatccggccgtcatgcatcagcagatggcggcgacgctc
gaacagtgcatcggcgaaatccgggcgatccagcagcacgcgcgcgccaaccacgacgcc
acgcggccgcgctggccgatgatcgtgctgcgttcgccaaaaggctggaccggcccgaag
gaagtggacggtcacaaggtggaaggctcatggcgagcgcatcaggtgccgattgccgat
ccggcgaccaaccgcgagagcctgaaactggtcgaggcgtggctgcgcagttacgagccc
gagtcgctgttcgacgaaaacggccggctcgtcgaggcgttgcgcgaactcgcgccacag
ggcgaacgccgcatcagcgcgaatccgcacgcgaacggcggcgtgctgtgcaagatgctc
gacatgccggcgtttcgcgattacgcagtcgaggtgaagcagcatgcgtccgcgtattcg
tcgcccactcaggtactcggccagtttttgcgcgacgtgatgcgcaggaacatgagcaac
ttccgcgtgttcggccccgacgagaccgccagcaacaagctgacggcgatttacgaggca
tccggcaagacctggctcgccgacgcccagcccaacgacgcggacggcggcgcgctgtcg
gccgacggacgtgtgatggaaatgctcagcgaacacacgctggaaggctggttcgaaggc
tatgtgctgacgggccgccacggcctcttcgcgacttacgaagcgttcgtgcacgtgatc
gattcaatgttcaaccagcacgccaagtggctcgaaaaagcgaagcgcgaactgcgctgg
cgtcagccggtgccgtccatcaacctgcttatcacgtcgctcgtctggcggcaggatcac
aatggcttcacgcatcaggatcccggctttctggatgtggtgaccaacaagagcccggac
gtggtgcgcatttatctgccgcccgacacgaactgtctgctgagcgtagccgatcactgt
ctgcgttcgcgcgattacgtgaacgtgatcgtgtcggacaaacagccgcatctgcagtat
ctggacatggaggccgccgtcacgcattgcacgaagggcatcggcatctgggactgggcg
tcgaccgatcagggcgccgagccggacgtggtgatggcgtgcgccggcgacatcgcgaca
atggaggcgctcgcggccgtgcagatcctcaaagcacgcttcccggacctgaagatccgt
ttcgtgaatgtggtcgatctattccggctgatgcccgagcacgcgcatccgcatggtctg
tcgggccgcgacttcgattcgctcttcacgaccagcaagccggtgattttcaatttccac
tcttacgcgtcgctggttcacaaactgacctacagccggaccaatcacgacaatctgcac
gtgcacggctatcacgagaagggcaacatcaacacgccgctggagctcgcgatcatcaat
caggtggaccgcttttcgctcgccatcgacgtgatcgatcgcgtgccgaggctgcgcggc
gtcggcgatcacacgaaggagtggctgcgcgggcagatcatcgagcatctcgcctatgcg
catgccgagggcatcgacaaggaagaaatccgcaactggacgtggcaagactga

DBGET integrated database retrieval system