KEGG   Burkholderia sp. CCGE1001: BC1001_3706Help
Entry
BC1001_3706       CDS       T01424                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bug00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BC1001_3706
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BC1001_3706
Enzymes [BR:bug01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BC1001_3706
Two-component system [BR:bug02022]
 CheA family
  CheA-CheYBV
   BC1001_3706
Bacterial motility proteins [BR:bug02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BC1001_3706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(119495..120124)
Genome map
AA seq 209 aa AA seqDB search
MNPRPSIRPDVDAQRGAHRARACELVVIGGSAGGMEVIHLLLAALPASFAPAVMIVMHLP
PDPPSYLVHALAHRCVLPVIEPDAGDEIMPGRVHVAPPGYHMLVEVDKTVALSTDPAVRF
SRPSIDVLFESAAAVYREQLLALLLSGANDDGAQGLQHVRAWGGLTWVQDPGTATSPDMP
RTAIERGAADCIYSPETMARRLAAWPASL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtgaacccgcgcccaagcattcggcctgacgtcgacgcccagcggggcgcgcatcgcgcg
cgcgcgtgcgaactcgtcgtgatcgggggctcggcgggcggcatggaggtgatccacctg
ctgctcgccgcgttgccggcaagttttgcaccggctgtgatgatcgtcatgcatctgccg
ccggacccgcccagctatctcgtgcacgcgctggcccaccggtgcgtgttgccggtgatc
gagccggacgccggcgacgagatcatgccgggccgcgtgcacgtcgcgccgcctggctat
cacatgctggtcgaggtggacaaaacggttgcgctttcaacggatcccgccgtgcgcttc
tcgaggccttccatcgacgtcttgttcgagtccgcggcagcggtgtatcgcgagcagctg
ctcgcgctcctgctgtccggcgcaaacgacgacggcgcgcaaggtttgcagcatgtgcgc
gcgtggggcgggctcacgtgggtgcaggatcccggcaccgcgacctcgcccgacatgccg
cgcaccgcgatcgagcgcggcgcggccgattgcatctattctcccgaaaccatggcccgg
cggctcgcagcatggccggcctctctttga

DBGET integrated database retrieval system