KEGG   Burkholderia sp. CCGE1001: BC1001_4057Help
Entry
BC1001_4057       CDS       T01424                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BC1001_4057
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1001_4057
  Lipid metabolism
   00071 Fatty acid degradation
    BC1001_4057
  Amino acid metabolism
   00350 Tyrosine metabolism
    BC1001_4057
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BC1001_4057
   00626 Naphthalene degradation
    BC1001_4057
Enzymes [BR:bug01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BC1001_4057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(510690..511676)
Genome map
AA seq 328 aa AA seqDB search
MRAMVFDGTAPVLRERQMAEPRPAAGQLLIDVHACGVCRTDLHVIDGELAHPKEPLIPGH
EIVGTVAALGDGVTGFAAGDRVGVPWTGSTCGHCRYCASGRENLCDEPGFTGYTIDGGYA
ERTVADSRYCLHLPERYADVEAAPLLCAGLIGYRTLSMAGDARAIGIYGFGAAAHIVAQV
ALHQGRTVFALTRPGDTAAQQFALRLGVQWAGGSDETPPEQLDAALIFAPAGPLVPAALK
AVAKGGVVVCGGIHMSDIPSFPYALLWGERRVCSVANLTRADGHAFMQLAADVPLDIETT
PYALADANRALNDLRDGSVNGAAVLCMR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcaatggtgttcgacgggaccgctccggtgctgcgtgaaaggcagatggccgag
ccgcggccggccgcgggtcagttgctgatcgacgttcacgcatgcggcgtgtgccgcact
gacttgcacgtgatcgacggagaactcgcgcatccgaaagagcccctcattcccggacat
gaaatcgtcgggaccgtggcggcgctgggcgacggcgtcacgggcttcgcggcaggcgat
cgcgtcggcgtgccgtggacaggctctacctgcggccactgccgctattgcgcgagcggc
cgcgagaatctatgcgacgagcccggcttcacgggttacacgatcgacggcggttacgcg
gaacgcaccgtcgccgatagccgctactgcctccacctgcccgagcgctatgccgatgtc
gaagccgccccgcttctgtgcgcgggcctgatcggctaccgcacgctgagcatggcgggc
gatgcccgcgcaatcggcatctacgggttcggtgcggccgcgcatatcgtcgcgcaagtg
gcgctgcaccaggggcgcacggtgttcgccctgacgcgccccggcgacaccgccgcgcag
cagttcgcgttgcggctcggcgtgcagtgggccggcggcagcgacgagacgcccccggag
caactcgacgcagcgctgattttcgcgcctgccgggccgctcgtgcccgcagcgttgaag
gcggtggcgaagggcggcgtggtggtgtgcggcggcatccatatgagcgatattccgtcg
ttcccgtacgcgctgttgtggggcgagcggcgcgtgtgttcggttgccaacctcacgcgc
gcggatggtcacgctttcatgcaactcgcggcggatgtgccgctcgacatcgagaccacg
ccctatgcactcgcggatgcaaaccgcgcgctaaacgacctgcgcgacggcagcgtcaac
ggcgcggccgtgttgtgtatgcggtag

DBGET integrated database retrieval system