KEGG   Burkholderia sp. CCGE1001: BC1001_4096Help
Entry
BC1001_4096       CDS       T01424                                 

Definition
Beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bug00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(552797..554782)
Genome map
AA seq 661 aa AA seqDB search
MRLGVCYYPEHWPESMWEDDARRMKALGIEQVRIAEFAWSRIEPAPGEYDWAWLNRAIDV
LGAAGLKVVMCTPTATPPKWLIDRHPDILPIGADGRPRAFGSRRHYDFSSPSYFAASQKI
CTAIAERYGKHPAVAYWQTDNEFGCHHTVVSYSPAAVGRFREWLKARYKTVDALNRAWGT
VFWSMEYRSFDEIDAPVATVTEAHPSHRLDYRRFASDEVARYNRMQVEIIRAHSPGRPVA
HNFMQLFTEFDHYKVAADLDVAAWDSYPLGALEEQWFAPEVKARWLRSGHPDFASFNHDV
YRGMSKLPFWVMEQQPGPVNWAMWNPAPLPGMVRLWSWEAFAHGAGCVSYFRWRQAPFAQ
EQMHAGLNTPDNRLDVGGSEASQVAEEIGTVLAANADADAVIRSKVALVYDYEAKWLFEI
HPQGADFHYPRFAFEYYSALRALGLDVDVVPVDAPLDGYSLIVVPPLPVVPTDLAARLAR
SGAQVVVGPRSGSKTPDLQIPANLPPGALADVLPLRVWRVESMRPNVTEAVHLAGVQDSG
SGHGVARHWRDFVESHDANPLDVLARFADGHPAYVRSGAFHYFASLFDDALTVRLFAQIA
QQAGIETIALGDSVRISRRGALTYVFNYGESAHTIAGVADDAFVIGSREVEPQGVAVYRS
K
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgcgccttggagtctgctattacccggaacactggccagagtcgatgtgggaagacgac
gcgcgccggatgaaagcactcggcatcgagcaggtgcgcattgccgagttcgcgtggagc
cgcatcgaaccggcgcccggcgaatacgattgggcgtggctcaatcgcgcgatcgacgtg
ctcggcgcagccggtttgaaggtcgtgatgtgcacgccgaccgcgacgccgcccaagtgg
ctgatcgaccgtcatccggacatcttgccgatcggcgccgatggccgcccgcgcgcgttc
ggttcgcggcgccattatgatttttcgtcgccgtcgtatttcgcggcttcgcagaagatc
tgcacggcgattgcagagcgctacggcaagcacccggccgtggcttactggcagaccgat
aacgagttcggttgccatcacacggtggtcagctattcaccggcagcggtggggcgtttt
cgcgagtggctgaaggcgcgctataaaacggtcgacgcattgaaccgtgcgtggggtacc
gtgttctggagcatggagtaccgcagcttcgacgaaatcgacgcgccggttgctacggtc
accgaagcacatccttcgcaccggctcgactaccggcgttttgcgtcggacgaagtggcg
cgctataaccgcatgcaggtcgagatcatccgcgctcattcgccgggacgcccggtcgcg
cacaacttcatgcagcttttcaccgagttcgatcactacaaggtggcggccgatctcgac
gtcgctgcctgggacagctatccgctcggcgcactggaagagcaatggttcgcgcccgaa
gtgaaggcgcgctggctacgcagcggtcaccccgactttgcgtcgttcaatcatgacgtg
tatcgcggcatgtcgaagctgccgttctgggtcatggagcagcagccgggtccggtgaac
tgggccatgtggaatcccgcgccgctgccgggcatggtgcgtttgtggagctgggaggcg
ttcgcgcacggcgcgggctgtgtgtcgtatttccgctggcgtcaggcgccgttcgcgcag
gagcagatgcatgcgggtctgaatacgcccgataatcgcctcgacgtgggggggagcgaa
gcgtcgcaagtggccgaagaaatcggtaccgtgctcgcggcaaacgccgatgcggacgcg
gtcatccgttcgaaggtcgcgctcgtctacgactacgaagcgaagtggctgttcgagatt
catccgcagggcgcggattttcattacccgcgctttgccttcgagtactactcggcgctg
cgcgcgctaggcctcgatgtcgatgtcgtgccggtcgacgcgccgctcgacggctacagc
ctgatcgtcgtgccgccgctgccggtcgtgccgacggatcttgcagcgcgtcttgcacgc
tcgggcgcgcaggtcgtcgtcggtccgcgcagcggttcgaagacgccggacttgcagatt
ccggcgaaccttccgccgggcgcgctcgccgatgtgttaccgctgcgcgtatggcgcgtc
gaatcgatgcgacctaacgtgaccgaagccgtgcatcttgccggtgtgcaggactcgggc
tcggggcatggcgtcgcacggcactggcgcgatttcgtcgaaagtcacgacgcgaatccg
ctcgacgtgctcgcgcgtttcgccgacgggcaccccgcgtatgtgcgaagcggtgcgttt
cactacttcgcgagcctcttcgacgatgcattgacggtgcggctctttgcgcaaattgcg
cagcaggcaggcatcgagacgatagcgcttggcgatagcgtgcgtatcagccggcgcggt
gcgctgacctacgtgttcaactacggcgagtccgcccacaccattgccggcgtagcagac
gacgcgttcgtgattggctcgcgtgaggtggaaccgcagggcgtggcagtgtatcgatcg
aaatga

DBGET integrated database retrieval system