KEGG   Burkholderia sp. CCGE1001: BC1001_4250Help
Entry
BC1001_4250       CDS       T01424                                 

Definition
1-phosphofructokinase
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BC1001_4250
Enzymes [BR:bug01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     BC1001_4250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:729634..730668
Genome map
AA seq 344 aa AA seqDB search
MNTVVTVTPNPALDQTVRVANLALGEVNLAASLEFNAGGKGVNVAGCLADYGIATLVTGL
LGSDDAAAFDALFADKQIVDRFVRIAGRPRINVKLVDTARDQTTDINLATSLPTAANVDA
LERRVVELAAPGRWFVLAGSLPPGVDVSFYRRLTRALHAAGARVALDTSGAPLAEALAAR
QPGDLPDLVKPNRAELEAALGRPLADDDALIEAACELVERGIRHVVVSLGERGALGVARP
PLQVQPQDGAAACEGWRAAPLRVPVASTVGAGDALVAGLVASLAEGRSWPEAGRRATAFA
AGKLARVGPHLPDRATLEALAAQVELRTFSVAAKPLRVTQHQAV
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaacacggtcgtcaccgttacgccgaacccggcgctcgaccagaccgtgcgcgtcgcg
aatctcgcactcggcgaggtcaacctcgccgcatcgctcgaattcaacgcgggcggcaag
ggcgtgaacgtggcgggctgtctcgccgactacggcatcgcgaccctcgtcacgggcctg
ctcggttccgacgacgccgccgcattcgatgcgctgttcgccgacaagcagatcgtcgac
cgcttcgtgcggattgccgggcgcccgcgcatcaacgtgaagctcgtcgataccgcgcgc
gaccaaaccaccgacatcaatctcgcaacctcgctgcccaccgcagccaatgtcgacgca
ctggagcggcgcgtggtcgaactcgccgcgccgggacgctggtttgtgctcgcgggcagt
ttgccgccgggcgtcgacgtgtcgttttaccggcggctcacgcgcgcgttgcatgcggcg
ggcgcgcgcgtcgcgctcgacacgagcggcgcgccgctcgccgaagcgctcgcggcacgc
caacccggcgacttgcccgatctcgtgaagccgaatcgcgcggaactggaagccgcgctg
ggccgtccactcgccgacgacgacgcgttgatcgaggctgcgtgcgagttggtcgaacgc
ggcatccgccatgtggtggtttcgcttggcgagcgcggcgcgctcggcgtcgcgcgcccg
ccattgcaggtgcaaccgcaggacggcgccgcggcctgcgaaggctggcgcgccgcgccg
ttgcgcgtgccggtggcgagcaccgtcggcgccggcgatgcgctcgtcgcgggcctcgtc
gccagtctcgccgaagggcgttcgtggcccgaggccggccgacgcgcgacggccttcgcc
gccggcaagctcgcgcgtgtcggcccgcatctgccggatcgcgcgacgctcgaggccctc
gcggcgcaagtcgaactgcgtaccttcagcgtcgccgcgaagccgctgcgcgtgacccaa
catcaagccgtgtaa

DBGET integrated database retrieval system