KEGG   Burkholderia sp. CCGE1001: BC1001_4480Help
Entry
BC1001_4480       CDS       T01424                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bug  Burkholderia sp. CCGE1001
Brite
Enzymes [BR:bug01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BC1001_4480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:976405..977286
Genome map
AA seq 293 aa AA seqDB search
MSASPLSSVETGDHAVLLLHGLSSSPLELRFLARLLADEGFVTHTPELPGYSAGTGHQPM
EQWISAAVAEFDKLAARHRHVSVCGLSMGATLAAALAHERPAARALLLLSITLSYDGWAI
PWYRFLLDYVYYTPMRSRYRYREHEPYGLRNEALRSKIARAMQKNDISEVGPASISMPAL
HEAGRLAGWVRKKLKGVRTDCLILHAIDDETSSPHNARFVGTHIGASFLRTIWLDDSYHM
ITSDNEREVVARECALFLRESVAATVSTTTPTPVISRALARRLRQLATVARKE
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcctcccctctttcgagcgtggaaaccggcgatcacgccgtcctgctgctgcac
ggtctgtcgagctcgccgctggagctgcgctttctcgcccgccttctcgcggacgagggc
ttcgtcacccatacgcccgagttgcccggctacagcgcaggcaccggacatcagccgatg
gaacagtggatcagcgccgccgtcgccgagttcgacaagctcgccgcgcgccaccgccat
gtctccgtctgcggtctctcgatgggcgccaccctcgccgccgcgctcgcgcacgaacgg
ccggccgcgcgcgccttgctgctgctgtcgatcacattgagctacgacggctgggcgatc
ccgtggtaccgctttctgctggactacgtctattacacgccgatgcgctcccgttaccgc
taccgcgagcacgaaccgtacggcctgcgcaacgaagcgttgcgctcaaagatcgcgcgc
gcgatgcagaagaacgacatcagcgaagtcggacccgcgtccatcagcatgccggcgctg
cacgaggccggccggctggcgggctgggtgcgcaagaagctgaagggcgtccggacggac
tgcctgattctccatgccatcgacgacgagacctcgagtccgcacaatgcgcgattcgtt
ggcacgcacatcggggcttcttttctgcgaaccatctggcttgacgactcctatcacatg
atcacgtccgacaacgagcgcgaagtcgtcgcgcgcgaatgtgcgctttttctgcgggaa
agcgtggcggccaccgtctccaccacgacacccacgcctgtcatctcgcgcgcgcttgcg
cgccgcctgcggcaactggcgaccgtagcgaggaaagaatga

DBGET integrated database retrieval system