KEGG   Burkholderia sp. CCGE1001: BC1001_4707Help
Entry
BC1001_4707       CDS       T01424                                 

Definition
ROK family protein
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1001_4707
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1001_4707
   00520 Amino sugar and nucleotide sugar metabolism
    BC1001_4707
Enzymes [BR:bug01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     BC1001_4707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1240860..1241660)
Genome map
AA seq 266 aa AA seqDB search
MATSKDKAATSNERILAIDVGGTGLKAAIINANGEMQTERVRVATPHPCTPEQLVDALAA
LVQPLIAKAPAQLMSIGFPGVVRDNRILTAPHFGVEGWHGFALADLLAQKLGGLPVRMIN
DAEMQGFAAIEGKGIEFVLTLGTGAGTALFRDGELMPHLELAHHPVSKKGVAYDEYIGEA
AREKAGNKRWNRRVHKVIGILESLVNYDKLWVGGGNAARLTFELPANVATVSNDAGIEGG
ARLWHPRSVRETRQLPEANARTGKFK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtggcgacatccaaagataaagcggcaaccagtaacgagcggattcttgcaatcgacgtc
ggcggcacgggtctgaaagcggccatcatcaacgcgaatggcgagatgcaaaccgaacgc
gtgcgggtcgcgacgccgcatccgtgcacgccggaacaactcgtcgatgcgctggccgca
ctcgtccagccgctgatcgcgaaggcgccggcgcagctgatgtcgatcggctttcccggc
gtggtgcgcgacaaccgcattctgaccgcgccgcatttcggcgtggagggctggcacggc
tttgcgctcgccgatctgctcgcgcaaaaactcggcggcttgcccgtgcgcatgatcaac
gacgccgaaatgcagggctttgcggcgatagaaggcaagggcatcgaattcgtgctgacg
ctcggcaccggcgcgggcacggcgctctttcgcgacggcgagctgatgcctcatctcgag
cttgcgcatcatccggtcagcaagaaaggcgtggcttacgacgagtacatcggcgaggcc
gcgcgcgaaaaggcagggaataaacgctggaaccggcgcgttcataaggtgatcggcatt
ctcgaatcgctcgtgaattacgacaaattgtgggtcggaggcggcaatgcggcgcgcctc
acgttcgagctgcccgccaacgtggccaccgtctcgaacgatgcgggcatcgagggcggc
gcgcggctgtggcatccgcggtcggtgcgcgaaacccgtcagttacccgaagcgaatgcg
cgcacgggtaagttcaaatga

DBGET integrated database retrieval system