KEGG   Burkholderia sp. CCGE1001: BC1001_4906Help
Entry
BC1001_4906       CDS       T01424                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BC1001_4906
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BC1001_4906
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BC1001_4906
Enzymes [BR:bug01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BC1001_4906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1471003..1471815
Genome map
AA seq 270 aa AA seqDB search
MSRIKNTFAALSKQGKKGLIPFMTAGDPDPARTVEFMHALAAGGADVIELGVPFSDPMAD
GPVIQQSSERALAHGVSLRHVLADVKRFRETNQTTPVVLMGYANPIERMGTEAFAEAARE
AGVDGVLVVDYPPEECANFAEKMRSAGIDPIFLLAPTSTDERIAEVGKIASGYVYYVSLK
GVTGAANLDVSSIASKIPAIKSRVPLPVGVGFGIRDAETARLVAEVSDAVVIGSRIVQLL
EQAAPDTAAETLRRFVAEVREALDSVATAR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtatcaaaaacacgtttgctgcgttgtccaagcagggcaaaaaaggcctgatt
cctttcatgacggccggcgacccggacccggcgcgtaccgtcgaattcatgcacgcgctc
gccgctggcggcgcggacgtcatcgaactcggcgtgccgttttccgaccccatggccgac
ggcccggtaatccagcagtcgtcggaacgcgcattggcgcacggcgtgtccttgcgtcac
gtgctcgccgacgtcaagcggttccgcgaaaccaaccaaaccacgccggtcgtgctgatg
ggctacgccaatccgatcgagcgcatgggcaccgaagcctttgccgaggcggcgagggaa
gcgggcgtcgacggcgtgctggtcgtcgactatccgccggaagaatgcgctaacttcgcg
gaaaagatgcgttccgccgggatcgatccgatctttctgctggcacccacgtcgaccgac
gagcgtattgcagaagtcggcaagatcgcgagcggttacgtctactacgtgtcgctaaaa
ggtgtgaccggcgcggcaaatctggacgtttccagcatcgcgagtaaaatcccggccatc
aagtcgcgcgtgcccctgccggtcggcgtcggttttggcattcgtgacgcggaaacggcg
cgtctcgtggccgaagtttccgacgcggtggtgatcggcagccgtatcgtccaattgctc
gagcaggcggcccccgacaccgccgccgagacgctgaggcgtttcgtcgccgaggtgcgc
gaggcgctcgatagcgtcgcgactgcccgataa

DBGET integrated database retrieval system