KEGG   Burkholderia sp. CCGE1001: BC1001_4918Help
Entry
BC1001_4918       CDS       T01424                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BC1001_4918
Enzymes [BR:bug01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BC1001_4918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1484222..1486423)
Genome map
AA seq 733 aa AA seqDB search
MSTRRSGDTIATLATRAGFEVEWEDAHHKVHRVPEKTLAVLLERMGLPCGNATQIRQSAA
ALEAELSGRKLPPLMTAEVGRGIALPAAAIRSGSHYRIELESGSIIDGRFTAPKGEEALL
APIDEPGYHTLVIHEQRMTLAVAPSRCYTVADAWRSLHDDDARADAPPLWGMAAQLYGLR
RVGDGGIGDYSALARIAVESARRGAHALAVSPTHAMFSAEPNRFSPYSPSSRLWLNVTHI
DPAAVFGEDTLRAAMQSTGAVDAWTELEGLPLIDWPKAVVLKLKLLRALFENFCTEERAH
DAPRALEFHGFCERAGRALEDHARFEALQAAQLAKGGNGHWRDWPEALRDPRSPEVEAFA
QAQRHEVDFHLFLQWLAAKGLSHAQHTAREAGMAVGLIADLAVGCDSAGSHAWSYRDDML
QGVSVGAPPDLFNQAGQSWGLTTFSPRAMRTQGFSAFIDMLRAAFAHAGGIRIDHILGLR
RLWLVPEGESARNGAYLRYPLEDLLRLIALESWRHRAIVIGEDLGTVPPGFRERLDEHGI
AGIRVLWFERDEDGSGFKPPQAWDRNAVGTTTTHDLPTVAGWWAGSDIAWRNRIGQTMAR
PDGRDPEEAAQEERASDRAELWRAFQQAGVAAPDVPAPPPESPPVDEALAFVAATPGPLV
TFPLEDLLAHSEQPNLPGSIDEHPNWRRRMNLPIDEMFLDDTFCDRLLAVDRARRAATVA
TPPANPASEPDTP
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
gtgagtacccgacgttccggcgatacgatcgccaccctcgcgacgcgcgcgggcttcgag
gtggaatgggaagacgcgcatcacaaggtgcaccgcgtgcccgagaagacgctcgccgtg
ctgctcgaacggatgggcctgccgtgcggtaacgcgacgcagatccgtcaaagcgcggcc
gcgctcgaagccgaactgtccggccgcaaactgccgccgctgatgaccgccgaagtcggc
cgcggcattgccttgccggccgccgcgatcaggtcgggcagccactaccggatcgagctg
gagagcggctcgatcatcgacgggcgctttaccgcgcccaaaggcgaagaagcgctgctc
gcgcccatcgacgaacccggttatcacaccctcgtgattcacgagcagcgcatgacgctc
gcggtcgcgccgtcacgctgctacaccgtcgccgacgcatggcgcagtctgcatgacgac
gacgcacgcgccgacgcgccgccgctgtggggcatggccgcgcaactctacggcttgcgt
cgcgtgggcgacggcggcatcggcgactattcggcactcgcgcgaatcgcggtggaaagc
gcgaggcgcggcgcgcatgcgctcgccgtcagtccgacgcacgcaatgttcagcgcggag
ccgaaccgcttcagcccgtattcaccgtcgtcgcgtttgtggctgaacgtcacgcatatc
gacccggcggccgtgttcggcgaagatacgttgcgcgccgcgatgcagtccaccggggcc
gtcgacgcgtggaccgaactcgaaggcttgccgcttatcgactggcccaaggccgtcgtg
ctcaagctgaaactcttgcgcgcgctgttcgaaaacttctgcacagaggaacgcgcgcac
gacgcgccgcgcgcgttggaatttcacggtttttgcgaacgtgccggacgagcgctcgaa
gaccatgcgcgtttcgaagcgctgcaggccgcgcagctcgcgaagggcggcaacggccat
tggcgcgactggcccgaagcgttgcgcgatccgcgcagtccggaagtggaggcgtttgcg
caggcgcagcgccatgaagtcgactttcacctctttttgcaatggctcgccgcgaagggt
ctgtcccacgcgcagcatacggcgcgcgaggccggcatggccgtaggcctgatcgccgat
ctcgcggtgggctgcgacagcgccggcagccacgcatggtcctatcgcgacgacatgctg
caaggcgtgtccgtcggcgcgccgcccgacctcttcaaccaggcgggacaaagctggggg
ctcaccactttctcgccgcgcgcgatgcgcacgcaaggcttctcggcgttcatcgacatg
ctgcgcgccgcgttcgcgcacgcgggcggcatccgcatcgatcacattctcggtttgcgg
cgcctgtggctcgtgccggaaggcgagagcgcgcgcaacggcgcgtatctgcgctatccg
ctcgaagacctgctgcggctcatcgcgctcgaatcgtggcggcatcgcgcgattgtgatc
ggcgaggatctcggcacggtgccgcccggttttcgcgagcggctcgacgagcacggcatt
gccggcatccgcgtgctgtggttcgagcgcgacgaggacggcagcgggttcaagccgccg
caggcatgggaccgcaatgcggtcggcacgaccaccacgcacgatctgccgaccgtcgcc
ggatggtgggccggcagcgacatcgcgtggcgcaaccggattgggcagaccatggcgcgc
cccgacggccgcgatcccgaagaagccgcgcaggaagagcgcgcgagcgaccgcgccgaa
ctgtggcgcgcgttccagcaagcaggcgtagccgcgcccgatgtgcccgcgccgccgccg
gaaagcccgcccgtcgacgaagcgcttgcctttgtcgcggccacgccgggaccgctcgtt
acgtttccgctcgaagatctgctcgcgcacagcgaacagccgaatctgccgggctcgatc
gacgagcatccgaactggcgccgccgcatgaatctgcccattgacgaaatgtttcttgac
gacaccttttgcgaccggctgctcgcggttgaccgcgcgcggcgcgccgcgaccgttgcc
acgcctcccgccaatcctgcttcggagcctgatacgccatga

DBGET integrated database retrieval system