KEGG   Burkholderia sp. CCGE1001: BC1001_5203Help
Entry
BC1001_5203       CDS       T01424                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00440  Phosphonate and phosphinate metabolism
bug01100  Metabolic pathways
bug01120  Microbial metabolism in diverse environments
bug01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BC1001_5203
Enzymes [BR:bug01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BC1001_5203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: ADX58584
JGI: BC1001_5203
UniProt: E8YSR3
Position
2:1811198..1812922
Genome map
AA seq 574 aa AA seqDB search
MNAREPAFVSASRSARLRQMLVSNELEFMMEAHNGLSARIVREAGFKAIWGSGLAISAQF
GVRDNNEASWTQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIE
DKQFPKTNSFINGEAQPLADIDEFCGKIKAGKDSQSDEHFSIVARVEALIAGWGMDEALR
RAEAYRRAGADAILIHSKLSRPDEILEFAREWAGRAPLVIVPTKYYSTPTEVFREAGIST
VIWANHLIRAATSAMQAVAREIHTSETLVNVEDRIAAVNEIFRLQDADEYSEAEDRYLSS
GRAAGSAVVLAASRGKGLEAVTQDRPKVMLPIAGKPLLRWLVDAFKKQGVNDITVVGGYR
ADAIDTAGIKLVVNEKHAETGELASLACALDKLSGDAVISYGDLLFRSYILRDLVESEAA
FSVVVDSSLTDAENASVRDFAWCSAADDRGLFGNKVLLRHVSSGQEASSAIASQTPHGRW
VGLLNVRGEGRERLQAVMRQLQARTDFASLDMPALLNALIEAGESIEVQYVHGHWRGVND
LEDFRRAGDFAHGQTPLAASVGGAGSDMANGAAQ
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccgcgaacccgcctttgtctccgcttcacgcagcgcacgcctgcgccagatg
ctcgtcagcaacgaactcgaattcatgatggaggcgcataacggcttgtccgcgcgcatc
gtccgcgaagccggtttcaaggcgatctggggctcgggccttgcgatctccgcgcagttc
ggcgtgcgcgacaataacgaagccagctggacgcaggtggtcgacaacctcgaattcatg
gccgacgcgagcgacctgccgattctgctcgacggcgacaccggttacggcaacttcaac
aacgtgcgccgcctcgtgcgcaagctggaacagcgcggcattgccggcgtgtgcatcgaa
gacaagcagtttccgaagaccaacagctttatcaacggtgaggcgcagccgcttgccgat
atcgacgaattctgcggcaagatcaaggccggcaaggactcgcagtcggatgagcacttt
tcgatcgtcgcgcgtgtggaagcgctgattgccggctggggcatggacgaggcgctgcgc
cgagcggaagcctaccgccgcgccggcgcggacgcgatcctgattcacagcaagctctcg
cgcccagacgagattctggaattcgcgcgcgagtgggcgggccgcgcgccgctcgtcatc
gtgccgacaaagtactacagcacgccgacggaagtgttccgcgaagccggcatcagcacg
gtgatctgggcgaaccatctgattcgcgcggcgacttcggccatgcaggctgtcgcgcgc
gaaatccacacgagcgaaacgctcgtcaacgtggaagacaggatcgccgccgtcaacgaa
attttccgtttgcaggacgcggacgaatactcggaagcagaagaccgctatctgtcgagc
ggccgcgcggcaggctccgcggtcgtgctggcggcgagccgcggcaaggggctcgaagcc
gtcacgcaggaccgccccaaagtcatgctgccgattgccggcaagccgctgttgcgctgg
ctcgtcgacgcgttcaagaagcagggcgtcaacgacatcacggtggtcggcggctatcgc
gccgacgccatcgatacagcgggcatcaagctcgtcgtcaatgaaaagcatgccgagacg
ggcgaactcgcgtcgctcgcgtgcgcgctggacaagctctcgggcgatgccgtgatttcc
tacggcgacctgctgttccgcagctatatcctgcgcgatctggtggaaagcgaggcggcg
ttcagcgtagtggtcgattcctcgctgaccgacgcggaaaatgcgagcgtgcgcgacttc
gcgtggtgctcggccgccgacgaccgggggctcttcggcaacaaggttctgctgcgccat
gtgtcgagcggacaggaggcgtcgtcggcgatcgcctcgcaaacgccgcatggccgctgg
gtcggcctcctgaacgtgcgcggcgaaggccgcgagcgtctgcaggcggtcatgcgccag
ttgcaggcgcgcaccgatttcgcgtcgctcgatatgcctgcgttgctcaacgcgctgatc
gaagcaggcgaatccatcgaagtgcagtatgtgcacggccactggcgcggcgtcaacgac
ctcgaagacttccgccgcgcgggcgacttcgcgcacggccagacgccgctcgcggcgtct
gtcggcggtgcgggctccgacatggcgaatggagcggcgcaatga

DBGET integrated database retrieval system