KEGG   Burkholderia sp. CCGE1001: BC1001_5203Help
Entry
BC1001_5203       CDS       T01424                                 

Definition
phosphoenolpyruvate phosphomutase
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Metabolism of other amino acids; Phosphonate and phosphinate metabolism [PATH:bug00440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1811198..1812922
Genome map
AA seq 574 aa AA seqDB search
MNAREPAFVSASRSARLRQMLVSNELEFMMEAHNGLSARIVREAGFKAIWGSGLAISAQF
GVRDNNEASWTQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIE
DKQFPKTNSFINGEAQPLADIDEFCGKIKAGKDSQSDEHFSIVARVEALIAGWGMDEALR
RAEAYRRAGADAILIHSKLSRPDEILEFAREWAGRAPLVIVPTKYYSTPTEVFREAGIST
VIWANHLIRAATSAMQAVAREIHTSETLVNVEDRIAAVNEIFRLQDADEYSEAEDRYLSS
GRAAGSAVVLAASRGKGLEAVTQDRPKVMLPIAGKPLLRWLVDAFKKQGVNDITVVGGYR
ADAIDTAGIKLVVNEKHAETGELASLACALDKLSGDAVISYGDLLFRSYILRDLVESEAA
FSVVVDSSLTDAENASVRDFAWCSAADDRGLFGNKVLLRHVSSGQEASSAIASQTPHGRW
VGLLNVRGEGRERLQAVMRQLQARTDFASLDMPALLNALIEAGESIEVQYVHGHWRGVND
LEDFRRAGDFAHGQTPLAASVGGAGSDMANGAAQ
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccgcgaacccgcctttgtctccgcttcacgcagcgcacgcctgcgccagatg
ctcgtcagcaacgaactcgaattcatgatggaggcgcataacggcttgtccgcgcgcatc
gtccgcgaagccggtttcaaggcgatctggggctcgggccttgcgatctccgcgcagttc
ggcgtgcgcgacaataacgaagccagctggacgcaggtggtcgacaacctcgaattcatg
gccgacgcgagcgacctgccgattctgctcgacggcgacaccggttacggcaacttcaac
aacgtgcgccgcctcgtgcgcaagctggaacagcgcggcattgccggcgtgtgcatcgaa
gacaagcagtttccgaagaccaacagctttatcaacggtgaggcgcagccgcttgccgat
atcgacgaattctgcggcaagatcaaggccggcaaggactcgcagtcggatgagcacttt
tcgatcgtcgcgcgtgtggaagcgctgattgccggctggggcatggacgaggcgctgcgc
cgagcggaagcctaccgccgcgccggcgcggacgcgatcctgattcacagcaagctctcg
cgcccagacgagattctggaattcgcgcgcgagtgggcgggccgcgcgccgctcgtcatc
gtgccgacaaagtactacagcacgccgacggaagtgttccgcgaagccggcatcagcacg
gtgatctgggcgaaccatctgattcgcgcggcgacttcggccatgcaggctgtcgcgcgc
gaaatccacacgagcgaaacgctcgtcaacgtggaagacaggatcgccgccgtcaacgaa
attttccgtttgcaggacgcggacgaatactcggaagcagaagaccgctatctgtcgagc
ggccgcgcggcaggctccgcggtcgtgctggcggcgagccgcggcaaggggctcgaagcc
gtcacgcaggaccgccccaaagtcatgctgccgattgccggcaagccgctgttgcgctgg
ctcgtcgacgcgttcaagaagcagggcgtcaacgacatcacggtggtcggcggctatcgc
gccgacgccatcgatacagcgggcatcaagctcgtcgtcaatgaaaagcatgccgagacg
ggcgaactcgcgtcgctcgcgtgcgcgctggacaagctctcgggcgatgccgtgatttcc
tacggcgacctgctgttccgcagctatatcctgcgcgatctggtggaaagcgaggcggcg
ttcagcgtagtggtcgattcctcgctgaccgacgcggaaaatgcgagcgtgcgcgacttc
gcgtggtgctcggccgccgacgaccgggggctcttcggcaacaaggttctgctgcgccat
gtgtcgagcggacaggaggcgtcgtcggcgatcgcctcgcaaacgccgcatggccgctgg
gtcggcctcctgaacgtgcgcggcgaaggccgcgagcgtctgcaggcggtcatgcgccag
ttgcaggcgcgcaccgatttcgcgtcgctcgatatgcctgcgttgctcaacgcgctgatc
gaagcaggcgaatccatcgaagtgcagtatgtgcacggccactggcgcggcgtcaacgac
ctcgaagacttccgccgcgcgggcgacttcgcgcacggccagacgccgctcgcggcgtct
gtcggcggtgcgggctccgacatggcgaatggagcggcgcaatga

DBGET integrated database retrieval system