KEGG   Burkholderia sp. CCGE1001: BC1001_5582Help
Entry
BC1001_5582       CDS       T01424                                 

Definition
GMC oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:bug00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(2223292..2226702)
Genome map
AA seq 1136 aa AA seqDB search
MNRLSSAVTAMKSHYEVVVIGSGYGGAIAASRMARAGRSVCVLERGREFMAGEYPRTPFQ
GAEQIQYNTPAAQIGSPLALLEVHVNDDVNAVVGCGLGGTSLINANVALKLDPRLWDHAR
WPAALRADEAGRDTGYQRAWDMLQPSPVPARFRELPKLLALARSAEALGMAERFSTPPIT
VTFEDRTNAAGVAQKACTGCGDCNSGCNYDAKNSTHMNYLPDAVAHGAQIFTGAAVHSVT
RNAATQTWQVGYQLVRLGRESYDAPDLFVSADIVIVSAGTIGSTALLLRSRNEGLSVSGM
LGERFTGNGDVLAFAYNTDDTINGVGWGAHGEGDIPPVGPTITGLIDHRNTVDVKDGFVI
EEGSLAGPVGAALVGMLGAAAPLAGVDVSGPRTADRQLAYDARVVESFLHGPYRGALNHT
QSYLVMAHDDESGQISVNEKGRPRIAWENAGKQPIYETVEETLKNATVPLGGKYLRDPIS
NDIFGNRTVTVHPLGGCPMGEEAEHGVVDHMGRVFSGMAGTAVHDGLYVMDGAVMPMSLG
VNPLWTISALAERNCALLAASRGWTIDYDSKGTAAAPPPLKIGLRFTETMVGHYTPTGAS
KDAASPMAFTLTVESDDLADMLSDPNHLARTAGTLTCPALSAQPMTITDGTFNLFVADPQ
DVDERNMNYRMTLNSAEGKTYYLSGQKIITRTSPLELWEQTNTLYARVFDTPHADAAPLG
SATLIITPENFLKQQRTLEVTNAPDLATRLEWTLKFGKFFAGVLFSEYGGIAAPLQYYDP
DAKPRLKRALRAPAPQVFFFDTPDGTRLRLTRYVDPARKNARPVLLIHGSGVSSRIYSTD
LIDTNLVEYLCAAGYDVWLVDLRVSIEMPSVLVPTNVDKVALEDIPAAVTKIREVTGATA
IQALGHCMGGLALSMSLMAGLEGVRSAVISQVAVHPVPPTLGRIKAGLHIPDIMQHLGVT
DLNAYTQDEKWPHNLFDEALRLYPVDHDEGCGNPICHRATFMYGLLYEHAQVSETLHSNL
QELLGVHDVGVFRHLAAMVRAGNVVDADGNDVYLRGARGMKGLAGMRIPIGFIHGDRNET
YVPKSTALTYQMLVDAFPEQPYERYLIPGYGHIDCIFGKNAAVDVYPTIARYLNAH
NT seq 3411 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcttatcgagcgccgtgacggcgatgaaatcgcactatgaagtggtggtgatc
ggttccggttatggcggcgccattgcggcgagccgcatggcccgcgcgggccgcagcgtc
tgcgtgctggagcgcgggcgcgagttcatggccggcgaatacccgcgcaccccgtttcag
ggcgccgagcagatccagtacaacacgcccgccgcgcagatcggctcgccgctcgcgctg
ctcgaagtgcatgtgaacgacgacgtcaacgcggtggtcggctgcggcctcggcggcacc
tcgctgatcaacgcgaacgtcgcgttgaagctggatccgcgcctgtgggaccacgcgcgc
tggcccgctgcgctacgtgcggacgaggccggacgcgacaccggttatcagcgcgcatgg
gacatgttgcaaccctcgccggtaccggcccgattccgcgaattgcccaagctgctcgcg
ctcgcacgatccgccgaggcgctcggcatggcggagcgcttcagcacgccgcccatcacc
gtcactttcgaggatcgcacaaacgcggccggcgtcgcgcagaaagcctgcaccggatgc
ggcgactgcaactcgggctgcaactacgacgcaaagaattcgacgcacatgaactatctg
cccgacgccgttgcgcacggcgcgcagattttcacgggcgccgcggtgcattcggtgacg
cgcaatgccgctactcaaacgtggcaagtcggctatcagctggtgcgccttggccgcgag
agctacgacgcgccggacctgttcgtgagcgcggacatcgtgatcgtatccgcgggaacg
atcggctcgaccgccttgctgctgcgttcgcgcaatgaaggcctgagcgtgtcgggcatg
ctcggcgagcgcttcaccggcaacggcgacgtgctcgcgttcgcgtacaacaccgacgac
accatcaacggcgtcggctggggcgcgcatggggaaggcgatatcccgccggtggggcca
accatcacggggttgatcgaccatcgcaataccgtcgacgtcaaagacggcttcgtgatc
gaagaagggtcgctcgccgggccggtcggcgccgcgctcgtgggcatgttgggcgccgct
gcgccgctcgccggcgtggacgtgtcgggaccgcgcacggcggaccggcagctcgcctac
gacgcccgcgtcgtcgaaagcttcctgcacggtccgtaccgcggcgcgctcaatcacacg
caaagctacctcgtcatggcgcacgacgacgaaagcggtcagatcagcgtcaacgaaaaa
ggacggccgcgcatcgcatgggagaacgccggcaagcagccgatctacgaaacggtcgaa
gagacgctgaagaatgcgacggtgccgctcggcggcaaatacctgcgcgatcccatttcc
aacgacatcttcggcaaccgcaccgtgaccgtgcatccactcggcggttgcccgatgggc
gaagaggccgaacacggcgtggtcgatcatatgggccgcgttttcagcggcatggccggc
acggccgtgcacgacggcctgtacgtgatggacggcgcagtcatgccgatgtcgctcggc
gtcaatccgctgtggacgatctcggcgctcgccgagcgcaattgcgcgctgctcgccgcg
tcgcgaggctggacgatcgactacgactcgaagggcaccgccgccgcgccgcccccacta
aaaatcggcctgcgcttcaccgaaacgatggtcgggcattacacgccgaccggagcaagc
aaggacgcggcaagcccgatggcgttcacgctgaccgtcgagtccgacgacctcgccgat
atgctcagtgatccgaaccatctggcgcgaaccgccggcacactcacctgccccgccctt
tccgcgcagccgatgacgatcaccgacggcaccttcaatctgttcgtggccgaccctcag
gatgtcgacgagcgcaacatgaactaccggatgacgctcaactcagcggaagggaaaacc
tactatctaagcggtcagaagatcatcacgcgcacgtcgccgctcgaactgtgggagcaa
accaacacgctttatgcgcgcgttttcgacacgccacacgccgacgcggcgccgctcggc
agcgcgacgctgatcatcacgccggaaaatttcctgaagcagcagcgcacgctggaagtc
acgaacgcgccggatctggcaacgcgtctcgaatggacgctcaaattcggcaagttcttt
gcgggcgtgctgttcagcgagtacggcggcattgccgcgcctttgcagtactacgatccc
gacgccaagccgcgcctgaagcgagccttgcgtgcaccggcgccgcaggtgttcttcttc
gacacgcccgacggcacgcgtttgcggcttacgcgctatgtcgatcctgcgcgcaagaac
gcacgccccgtgttgctgattcacggctcgggcgtgtcgagccgcatctactccaccgac
ctgatcgacaccaacctcgtcgaatatctgtgcgccgcgggctacgacgtctggctcgtc
gatctgcgcgtgagcattgaaatgcctagcgtgctggtgccgaccaacgtcgataaagtc
gcgctcgaggacattcccgcagccgtcacgaagattcgcgaagtgaccggcgctacggct
atccaggcgctcggccattgcatgggcggcctcgcgttgagcatgtcgttaatggcggga
ctggaaggcgtgcgctcggcggtgatctcgcaggtcgccgtgcatccggtgccgcccacg
ctcggccgcatcaaggcaggactgcacattcccgacatcatgcagcaccttggcgtgacc
gacctcaacgcttacacgcaggacgaaaagtggccgcacaatctcttcgacgaggcgctg
cgtctctaccctgtcgaccacgacgagggctgcggcaatccgatctgtcaccgcgcgacg
ttcatgtacgggctgctctacgagcatgctcaggtgagcgaaacactgcattcgaacctg
caggaactgctcggtgtgcatgacgtcggcgtgttcaggcatctggccgcgatggtgcgt
gcgggcaacgtcgtcgacgcggacggaaacgatgtctatctgcgcggagcgcgcggcatg
aaaggccttgccggcatgcgcattcccattggcttcattcacggcgaccgcaacgaaacc
tatgtgccgaagagcaccgcgctcacctatcaaatgctcgtcgacgcctttcccgagcaa
ccttacgagcgctatctgattcccggttatggacatatcgactgcattttcggcaagaat
gcggcggtcgatgtttatccgactatcgcgcgctatctgaacgcgcattga

DBGET integrated database retrieval system