KEGG   Burkholderia sp. CCGE1001: BC1001_5808Help
Entry
BC1001_5808       CDS       T01424                                 

Definition
Magnesium chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bug00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:2492986..2494050
Genome map
AA seq 354 aa AA seqDB search
MNAVTESAHQGSAQKPAFPFAALIGQSALQQALLLAAIDPGIGGVLVSGPRGTAKSTAAR
ALAELLPHGQLVNLPLGASEDRLIGTLDIETVLRDGSVRFSPGLLAKAHRGVLYVDEVNL
LPDALVDALLDAAASGVNTVERDGVSHSHEASFVLIGTMNPEEGELRPQLIDRFGLMVEL
QNCFEPRVREQIVKARLAFELDPAGFRAGYAQQQAQYVERIRAAREALPQLSFDDALHAH
VSALCIDAAVDGLRADLVMLRAARALAAWDLADAVTMQHVDSVAEAVLAHRRRARGATPG
SSEAGPRDSSADSAEPGPLQQDSGGSDSDWGYLPAQPVGTTQVKGVVPLPLKKR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgtcacggaaagtgctcatcaaggctcggcgcaaaagcccgcttttccgttt
gccgcgttgatcggacaaagcgcgttgcagcaggcgttgctgctcgcggcgatcgatccg
ggaatcggcggcgtgctggtgagcggaccgcgcggaacggcgaaatcaacggcggcgcgt
gcgcttgccgagttgcttccgcacgggcagctcgtgaacctgccgcttggcgcaagcgag
gatcgcctgatcggcacgctcgatatcgaaaccgtgctgcgcgacggctccgtgcgcttc
tcgcccgggttgcttgcgaaagcgcatcgcggcgtgctgtatgtggacgaagtcaacctg
ctgcccgatgcgctcgtcgatgccttgctcgatgcggcggcgagcggtgtgaacaccgtt
gagcgcgatggcgtatcgcatagtcacgaggcgagcttcgtgctgatcggtacgatgaat
ccggaagaaggcgagttgcggccgcaattgatcgaccgtttcggcttgatggtggagttg
cagaactgcttcgaaccgcgcgtgcgcgagcagatcgtgaaagcgcggctcgcattcgag
ctcgatcctgccggctttcgcgccggttatgcgcagcaacaggcgcagtacgtcgagcgg
attcgtgcggcccgcgaggcgctgccgcaactttccttcgacgacgcactgcacgcgcac
gtgagcgcattgtgtatcgacgctgccgtggacggcttgcgcgccgacctcgtgatgctc
cgcgcggcacgtgctctggccgcgtgggatcttgcggacgcggtcacgatgcagcatgtc
gatagcgttgcggaggcggtgcttgcgcacaggcggcgcgcgcggggcgcgacccctggc
agcagcgaggcggggccacgcgattcgtcagcggattccgctgagcccggaccgttgcag
caagatagcgggggcagtgacagcgattggggttatttgcccgcgcagccggttgggacc
acacaggtcaaaggcgtcgtaccgcttccactaaaaaaacgctga

DBGET integrated database retrieval system