KEGG   Burkholderia sp. CCGE1001: BC1001_5835Help
Entry
BC1001_5835       CDS       T01424                                 

Definition
(GenBank) formaldehyde dehydrogenase, glutathione-independent
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00625  Chloroalkane and chloroalkene degradation
bug00680  Methane metabolism
bug01100  Metabolic pathways
bug01120  Microbial metabolism in diverse environments
bug01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bug00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    BC1001_5835
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BC1001_5835
Enzymes [BR:bug01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     BC1001_5835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C PALP FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ADX59200
JGI: BC1001_5835
UniProt: E8YWD8
Position
2:2531463..2532662
Genome map
AA seq 399 aa AA seqDB search
MSSNRGVVYLGQGKVEVQSIDYPKMVDPRGRAIGHGVILKVVSTNICGSDQHMVRGRTTA
EVGLVLGHEITGEVIEVGRDVETLSIGDLVSVPFNVACGRCPTCKSQHTGVCLNVNPSRA
GGAYGYVDMGGWIGGQAEYVMVPYADFNLLKFPDREQAMAKIRDLTCLSDILPTGYHGAV
MAGVKPGSTVYIAGAGPVGMAAAASARLLGAACTIVGDMNEARLAHARKMGFETVDLSKD
ATLGEQIEQILGKPEVDCAVDCVGFEAHGHGSSGSHEEAPATVLNSLMEITRAAGAIGIP
GLYVTDDPGAVDAAARKGSLSIRFGLGWAKSHSFHTGQTPVMKYNHNLMQAILWDRLPIA
DIVNVTVVSLDQAPDGYRQFDGGAPRKFVIDPHGLLKAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaatcgcggcgtcgtctatctggggcagggcaaagtagaagtgcaatcgatc
gactatccgaagatggtcgacccacgtggccgcgcaatcggccacggtgtgatccttaaa
gtagttagcacgaatatttgcggctcggaccagcacatggtgcgcggtcgcacgaccgcc
gaggtcggcctcgtgctcggccacgaaatcacaggggaggtgatcgaggtaggccgcgac
gtggagacgctcagcatcggcgaccttgtctcggtcccgttcaacgtggcgtgcggacgc
tgcccgacctgcaagtcgcagcacacgggcgtatgcctgaacgtgaacccgtcgcgcgcg
ggcggcgcttatggctacgtggacatgggcggctggatcggcggccaggccgagtatgtg
atggtgccgtatgccgacttcaatctgctgaagtttcccgaccgcgagcaggcgatggcg
aaaattcgcgatctcacgtgtctgtccgacattctgccgaccggttatcacggcgcggta
atggcgggcgtcaagccgggttcgacggtgtacatcgcaggcgcgggaccggtcggcatg
gccgcggcggcgtcggcgcgcctgttgggcgcagcgtgcacgatcgtcggcgacatgaac
gaggcacgcctcgcgcatgctcgcaagatgggcttcgagactgtcgatctttcgaaagat
gcgacgctgggtgagcagatcgagcagattctcggcaagccggaggtggattgcgcggtg
gactgcgtgggcttcgaagcgcatggccacggcagcagcggctcgcatgaggaagcgccg
gccacggtgctcaactcgctgatggaaatcacgcgtgccgcgggcgcgatcggcattccc
ggcctctatgtgaccgacgatccgggcgccgtcgacgccgccgcgcgcaagggcagcctg
agcatccgctttggtctcggctgggcaaagtcgcactcgttccatacgggccagacgccg
gtcatgaagtacaaccacaacctgatgcaggcgatcttgtgggaccgtttgccgattgcg
gacatcgtgaacgtgacggtggtgtcgctcgatcaggcgccggacggctatcgccagttc
gacggcggcgcaccgcgcaaattcgtcatcgatccgcatggtctgctgaaggcggcgtga

DBGET integrated database retrieval system