KEGG   Burkholderia sp. CCGE1001: BC1001_5883Help
Entry
BC1001_5883       CDS       T01424                                 

Definition
glycoside hydrolase family 24
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
bug  Burkholderia sp. CCGE1001
Brite
Enzymes [BR:bug01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     BC1001_5883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:2572874..2573503
Genome map
AA seq 209 aa AA seqDB search
MERAAFTAAVAIIAGVSVYLLYQQAATVAATTGESDYTALDAASTLVDEMTNGIANAVAP
TPASQMDISPQGELFIRSRERCSLKKYTLGDGGETIGWGHYGAYGTLPDTITQAQADAMF
SDDVQSRAAKWVRLYVTVDLTQEQFDALCSIAYNMSPRSFKKFADSVNAGNGIDGIANQS
VSWVAANLQNGIQNRRNAEMALFDSGVYA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgcggcctttaccgcagccgtcgcgatcatcgcgggcgtgtctgtctacctc
ctgtatcagcaggcggcaacggtcgcagcgacaacgggcgagagtgattacacggcgctc
gatgcagcgtcaacactggtggacgaaatgacaaacggaattgcaaacgcggtggcgcct
acgccggcttcgcagatggacatcagcccccagggcgagctgttcatccggagccgggag
cgctgctcgctgaaaaagtacacgctgggagacggcggcgaaacgatcggctgggggcat
tacggcgcttacggcacgctgcccgatacgatcacgcaggcgcaggcggacgcgatgttt
tcggacgacgtgcagagccgcgcggcgaagtgggtgcgcctgtatgtgacggtggacctc
acgcaggaacagttcgacgcgctctgctcgattgcctacaacatgagcccgcgcagcttc
aagaaattcgccgattcggtcaacgccggaaacggtatcgacggcattgcaaaccagtcg
gtgagctgggttgcggccaatctgcagaacggcatccagaaccggcgcaatgccgaaatg
gcgctgttcgactcgggagtgtatgcatga

DBGET integrated database retrieval system